SecReT6
Protein ID: 470463471
SecReT6 ID739
T6SS typei4b
Gene symbol-
Locus tagETAC_11505
StrainEdwardsiella tarda C07-087
Repliconchromosome [GenBank: NC_020796] [Browse all T6SS(s) in this replicon]
Location [Strand]2607629..2609116 [+]
Producttype VI secretion system protein EvpB
NoteTssC
UniProt IDM4TNS8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.30E-192, Aligned region: 67..490
Protein Sequence: 495 a.a.     [Download]
>gi|470463471|ref|YP_007629782.1| type VI secretion system protein EvpB [Edwardsiella tarda C07-087]
MSEQNLPESSAAESAALEGGLLDSIIAETRMARSDLEKARARDLLGEWVSEVLSGTVTVSGDVLASIEAR
IAQIDALLSAQLSAIMHEPAFQKLEGSWRGLHYLVHQSETGTGLKIRMLNVSRADLIRDFKSAAEFDQSA
LFKKVYEEEYGTFGGAPFAAMIGDYEFSNHPEDLFLLEEISHVAAAAHAPFLSAASAGMFGLDSLTELSI
PRDLAKGFDTVEYAKWKSLRQSEDARYIALALPHVLGRLPYGATTVPVESFNFEENVSGKEHGKYLWLNA
AYALGTRLTQAYAKYGWCAAIRGAEGGGLVEGLPAHTFTTDDGEVELKCPTEVAITDRREKELAELGFIA
LTHCKGTDYAAFFSTQSVQKPKEYDSDSANANARISCQLQYIMATSRFAHYLKSMVRDKIGSFMSRSECE
YFLNQWISNYVVGSDDAGQDIKAKYPLREARIDVSDIPGKPGFYKAVAYLKPHFQLEGLTASLRLVADLP
PPAQG
 
Nucleotide Sequence: 1488 bp     [Download]
>gi|470461182|ref|NC_020796.1|:2607629-2609116 Edwardsiella tarda C07-087, complete genome
ATGAGCGAACAGAACTTGCCAGAAAGTAGCGCCGCCGAGAGCGCTGCGCTAGAGGGCGGCCTGCTGGATA
GCATCATTGCGGAAACCCGGATGGCACGCAGTGATCTGGAGAAGGCGCGGGCCCGGGATCTGCTGGGGGA
ATGGGTCAGTGAGGTTCTGTCGGGCACCGTGACGGTATCCGGTGATGTGCTGGCCAGCATTGAGGCGCGT
ATCGCCCAGATCGATGCGCTGCTCTCCGCCCAGCTCTCCGCCATTATGCATGAGCCGGCGTTCCAAAAGC
TGGAGGGGTCATGGCGTGGGCTGCATTACCTGGTGCATCAAAGCGAAACCGGTACCGGCCTGAAAATCCG
CATGCTGAACGTCAGCCGAGCCGATCTGATCCGCGACTTTAAGAGCGCCGCCGAGTTTGATCAGAGCGCG
CTGTTCAAGAAAGTCTATGAGGAGGAGTACGGTACCTTTGGCGGCGCCCCCTTTGCGGCCATGATCGGAG
ATTATGAGTTCAGCAACCACCCGGAAGATCTGTTCCTGCTGGAGGAGATCTCACACGTTGCGGCGGCGGC
CCATGCCCCCTTCCTCTCTGCCGCCAGCGCAGGAATGTTCGGCCTGGATAGCCTGACAGAGCTGTCGATC
CCCCGGGATCTGGCCAAGGGCTTTGATACGGTTGAGTATGCCAAGTGGAAATCGCTGCGCCAGTCGGAGG
ATGCCCGCTATATCGCCCTGGCCCTGCCCCACGTGCTTGGCCGACTGCCTTACGGCGCGACGACGGTGCC
GGTTGAGTCATTCAATTTTGAGGAGAATGTCAGCGGCAAGGAGCATGGCAAATATCTGTGGCTGAATGCC
GCCTATGCGCTGGGCACCCGCCTGACTCAGGCCTATGCCAAATATGGCTGGTGCGCCGCCATCCGGGGTG
CCGAAGGGGGAGGCCTGGTGGAGGGACTGCCGGCGCACACCTTTACCACCGATGATGGCGAAGTCGAGCT
CAAGTGCCCCACCGAAGTGGCCATTACCGATCGCCGAGAGAAAGAGCTGGCCGAGCTGGGATTTATCGCC
CTGACCCACTGTAAGGGGACCGACTATGCCGCCTTCTTTTCGACCCAGTCGGTGCAAAAGCCCAAGGAAT
ATGACAGTGACTCCGCCAATGCCAACGCCAGGATCTCCTGCCAGCTGCAATATATTATGGCCACCTCACG
CTTTGCCCATTATTTAAAATCGATGGTCCGCGACAAAATCGGCAGCTTTATGAGCCGCAGTGAGTGTGAA
TATTTTCTCAATCAGTGGATCAGTAATTATGTGGTCGGCTCGGATGATGCTGGCCAGGATATCAAGGCGA
AATATCCATTACGGGAAGCCCGCATTGATGTCAGTGATATTCCGGGCAAACCGGGTTTCTATAAGGCAGT
AGCCTATTTAAAACCCCATTTCCAACTGGAGGGGCTGACCGCGTCTTTACGTCTGGTCGCCGATCTGCCG
CCGCCGGCGCAAGGCTAA