SecReT6
Protein ID: 470463474
SecReT6 ID739
T6SS typei4b
Gene symbol-
Locus tagETAC_11520
StrainEdwardsiella tarda C07-087
Repliconchromosome [GenBank: NC_020796] [Browse all T6SS(s) in this replicon]
Location [Strand]2611006..2611482 [+]
Producttype VI secretion system protein EvpE
NoteTssE
UniProt IDM4U1T8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 5.70E-22, Aligned region: 35..141
Protein Sequence: 158 a.a.     [Download]
>gi|470463474|ref|YP_007629785.1| type VI secretion system protein EvpE [Edwardsiella tarda C07-087]
MILRHLFRPSVLDRLFDDFPQERTERTSDRRYDLAHFRWAVRRDVEDVLNTRSALSLDIDQWPELEKSPL
NYGLPDCSNLSAANAEDREWIRQHIERAIDLFEPRLSQVRVHIHLDEKTGISQLIFRIEALLDVDPSPEP
VMFDAVLDVSTQLYRIDR
 
Nucleotide Sequence: 477 bp     [Download]
>gi|470461182|ref|NC_020796.1|:2611006-2611482 Edwardsiella tarda C07-087, complete genome
ATGATCCTTCGCCATCTCTTCCGCCCCTCCGTGCTGGATCGTCTGTTCGATGATTTCCCACAGGAGCGAA
CCGAACGGACATCAGACCGTCGGTATGACCTGGCCCACTTTCGCTGGGCCGTCAGACGGGATGTGGAGGA
TGTCCTGAATACGCGATCCGCGCTGTCGCTGGATATCGATCAGTGGCCTGAGCTGGAAAAGTCCCCCCTG
AATTACGGCCTGCCGGACTGCTCCAACCTGAGCGCCGCCAATGCCGAGGATCGGGAGTGGATCCGCCAGC
ATATCGAGCGGGCCATCGATCTGTTTGAACCCCGGCTGAGCCAGGTCCGGGTGCACATCCATCTGGATGA
GAAAACCGGCATCAGCCAGCTGATCTTCAGGATCGAGGCATTACTGGACGTCGATCCCTCGCCGGAGCCG
GTGATGTTCGATGCAGTGCTGGATGTTTCAACACAGCTGTACCGAATAGACAGGTGA