SecReT6
Protein ID: 470463475
SecReT6 ID739
T6SS typei4b
Gene symbol-
Locus tagETAC_11525
StrainEdwardsiella tarda C07-087
Repliconchromosome [GenBank: NC_020796] [Browse all T6SS(s) in this replicon]
Location [Strand]2611486..2613327 [+]
Producttype VI secretion system protein EvpF
NoteTssF
UniProt IDM4TMB4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.20E-214, Aligned region: 4..611
Protein Sequence: 613 a.a.     [Download]
>gi|470463475|ref|YP_007629786.1| type VI secretion system protein EvpF [Edwardsiella tarda C07-087]
MVELLPYYNRELAFLRQLGREFASQYPKVAGRLLLEEGVSEDPHVERLIEAVAFLCARVHHKIDEQFPEI
TNALLGILYPHYLRPIPSLSLVQFSVDPAQTNLSGPLRLPRHTSLLSRQVDGMACRFRTAYPVEIWPVSV
IHAGFAPARQTSLSVQQQGGAGLICIRLQTHPGHHLNTLGMDRLRFFLQGEPAVVHTLYELLFNNVTKVV
LRAGSAEWTLPASIISPVGFDEDESLFDYDARSSQAYRLLHEYFAFPDKFLFFDMTELLQATPLPEACRE
IDLVIHLSAFEREGRLAKLTDTIDASTFRLGCSPVVNLFRQRAEPLQVTHRKTEYPIIPDVRRPWGMEVY
SVDAVSKLVKHDGQEKIKRYRPLFGLHHANDSEPQRVFWMENRRGGIRGDDPGMDVYLSLVDLDFDPNQS
SSETLSIDVTCTNREFPSLLPFGGDRGDFEVDGGSPVTRIHCLRKPTPTLRPAHGRAAMWRLISHLNLNL
LSITGENEEATEAFRELLGLYNFSDSPALRQQIAGIVSINSQPATARLCSRNQAAVVRGIEITLVLDESQ
FEGSGVYLFSAVVERFVSQYGAINSFTRLHVRTRQREQALKRWPPRAGKAVLS
 
Nucleotide Sequence: 1842 bp     [Download]
>gi|470461182|ref|NC_020796.1|:2611486-2613327 Edwardsiella tarda C07-087, complete genome
ATGGTCGAGCTATTGCCCTACTATAACCGGGAGCTGGCGTTCTTACGTCAGTTGGGACGTGAGTTCGCCT
CCCAGTATCCCAAGGTGGCCGGACGCCTTCTGCTGGAGGAGGGGGTCTCGGAAGATCCCCATGTCGAACG
GCTGATCGAGGCCGTGGCATTTCTCTGCGCTCGAGTGCACCACAAGATTGATGAGCAGTTTCCCGAAATT
ACCAATGCGCTGCTGGGGATCCTGTATCCCCACTACCTGCGCCCGATCCCCTCGCTATCCCTGGTTCAGT
TTTCGGTCGATCCGGCGCAGACCAACCTATCGGGCCCACTGCGCCTGCCGCGGCATACCAGCCTGCTGTC
TCGCCAGGTAGATGGCATGGCATGCCGGTTTCGCACCGCCTACCCGGTGGAGATTTGGCCCGTGTCGGTC
ATCCATGCCGGCTTCGCCCCCGCGCGGCAAACCAGCCTGTCCGTGCAGCAGCAGGGAGGCGCCGGTCTGA
TCTGTATCCGCCTACAAACCCACCCGGGACATCATCTGAATACCCTGGGGATGGATAGACTGCGCTTCTT
TCTCCAGGGGGAGCCAGCCGTGGTGCACACCCTGTATGAGCTGCTGTTCAACAACGTGACCAAGGTGGTG
CTCCGCGCCGGATCGGCGGAGTGGACCCTGCCGGCCAGCATCATCTCACCGGTCGGATTCGACGAGGATG
AGAGCCTGTTTGACTACGATGCCCGCTCGTCCCAGGCCTACCGCTTACTGCACGAATACTTTGCCTTTCC
CGACAAGTTCCTGTTTTTTGACATGACCGAGCTGCTGCAGGCCACCCCGCTTCCGGAGGCCTGCCGGGAG
ATCGATCTGGTGATCCATCTGTCGGCGTTCGAGCGAGAGGGGCGCCTGGCCAAACTGACCGATACCATCG
ACGCCTCCACCTTTCGGCTGGGATGCAGCCCGGTGGTCAACCTGTTCCGGCAGCGGGCAGAGCCGTTGCA
GGTAACCCACCGTAAAACCGAGTACCCGATTATTCCCGATGTCCGCCGCCCCTGGGGCATGGAGGTCTAT
TCGGTCGATGCCGTCAGCAAGCTGGTCAAGCATGACGGGCAGGAGAAGATAAAACGCTATCGCCCCCTGT
TTGGCCTGCATCACGCCAACGACAGTGAGCCGCAGCGGGTATTCTGGATGGAAAACCGCCGCGGTGGGAT
CCGCGGGGATGACCCGGGCATGGATGTCTACTTATCCCTGGTGGATTTGGATTTTGACCCCAATCAGTCA
TCGTCGGAAACCCTGAGTATCGACGTGACCTGCACCAACCGAGAGTTTCCGTCCCTGCTGCCCTTCGGCG
GCGACCGGGGCGATTTCGAGGTGGACGGCGGCTCTCCCGTCACCCGCATCCACTGCCTGCGCAAGCCGAC
GCCCACCCTGCGCCCGGCCCACGGCAGGGCCGCCATGTGGCGTCTGATCTCCCACCTGAACCTGAACCTG
CTCTCCATCACCGGCGAAAACGAGGAGGCGACCGAGGCCTTCAGGGAGCTGCTCGGACTGTATAACTTCA
GCGACTCCCCCGCCCTGCGTCAGCAGATTGCCGGCATTGTCAGTATCAACAGCCAGCCGGCGACGGCGCG
CCTGTGCAGCCGGAATCAGGCGGCGGTGGTGCGGGGCATCGAAATCACCCTGGTGCTGGACGAGAGCCAA
TTTGAGGGCTCCGGGGTGTACCTGTTCAGCGCCGTGGTGGAGCGATTCGTCAGCCAGTACGGCGCCATCA
ACAGCTTTACCCGCCTGCACGTCCGCACCCGGCAGCGGGAACAGGCGCTCAAGCGCTGGCCGCCGCGGGC
GGGCAAGGCGGTGCTGTCATGA