SecReT6
Protein ID: 470463476
SecReT6 ID739
T6SS typei4b
Gene symbol-
Locus tagETAC_11530
StrainEdwardsiella tarda C07-087
Repliconchromosome [GenBank: NC_020796] [Browse all T6SS(s) in this replicon]
Location [Strand]2613324..2614349 [+]
Producttype VI secretion system protein EvpG
NoteTssG
UniProt IDM4TNT2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.90E-100, Aligned region: 16..317
Protein Sequence: 341 a.a.     [Download]
>gi|470463476|ref|YP_007629787.1| type VI secretion system protein EvpG [Edwardsiella tarda C07-087]
MSDALSPKSVLEQLYARPYEFDFFQAVRILELQQLRCGCQELPLRFRTHLSLATPASSVYALQPPAVDQP
QVMTINFMGLTGPSGALPTRYTEMLLARRLQHRDQTAHHFFDLLNHRLITLFYQAWRKHQATADLECGLQ
ADWRQMLLSLAGLGTLGLQNRLKKDGVNDDVFAYYAGRFGTRSLSEEGLRTLLTDYFSVPVEILPFQGRW
LKLDEADLLALGRQNCTLGEWPVLGRQVWDAQSQFRIRLGPMSYQQFQPFLPGGKDFRALTKLVRFAIEI
AVTFDIQLVLAASEVPPCTLGDSQAGAARPGWIGWLGGRPARLGDADEVVLQASESGKPAR
 
Nucleotide Sequence: 1026 bp     [Download]
>gi|470461182|ref|NC_020796.1|:2613324-2614349 Edwardsiella tarda C07-087, complete genome
ATGAGCGACGCCCTGAGCCCAAAGTCCGTGCTGGAGCAGCTGTATGCGCGGCCCTATGAGTTCGATTTTT
TTCAGGCCGTCAGGATACTGGAGCTGCAGCAGCTACGGTGTGGCTGCCAGGAGCTTCCGCTGCGCTTCCG
GACGCATCTCTCCCTGGCCACCCCGGCCAGCAGTGTCTATGCGCTGCAGCCGCCCGCGGTAGACCAGCCG
CAGGTCATGACCATCAACTTCATGGGGCTGACCGGTCCCTCTGGGGCGCTGCCGACGCGGTATACCGAGA
TGCTGCTGGCGCGTCGCCTGCAGCATCGGGATCAGACCGCCCACCACTTTTTTGATCTGCTCAATCACCG
TCTGATCACCCTGTTTTACCAGGCATGGCGCAAGCATCAGGCGACGGCCGATCTGGAGTGCGGCCTGCAG
GCCGACTGGCGCCAGATGCTGCTCTCCCTGGCCGGTCTGGGCACGCTGGGCCTGCAGAACCGGCTGAAAA
AAGACGGCGTCAATGACGATGTCTTTGCCTATTACGCCGGACGGTTCGGCACCCGCTCGCTCAGCGAGGA
GGGGCTGCGCACGCTGCTGACAGACTATTTTTCCGTGCCGGTCGAGATCCTGCCCTTTCAGGGCCGCTGG
CTGAAGCTGGATGAGGCGGACCTCCTCGCCCTGGGGCGCCAAAACTGCACTCTGGGAGAGTGGCCGGTGC
TGGGGCGACAGGTATGGGATGCCCAAAGCCAGTTTAGGATCCGCCTCGGCCCCATGAGCTATCAGCAGTT
TCAGCCATTTTTGCCGGGGGGCAAGGACTTTCGGGCGCTGACCAAGCTGGTCCGTTTTGCCATCGAGATC
GCCGTCACATTCGATATTCAGCTGGTGCTGGCCGCCAGCGAGGTCCCCCCCTGCACGCTGGGCGATAGTC
AGGCCGGGGCGGCCCGTCCCGGATGGATTGGCTGGCTGGGAGGCCGTCCCGCCAGGCTGGGGGATGCCGA
CGAAGTGGTATTGCAGGCGTCAGAGTCCGGGAAGCCCGCGCGATAA