SecReT6
Protein ID: 470463477
SecReT6 ID739
T6SS typei4b
Gene symbol-
Locus tagETAC_11535
StrainEdwardsiella tarda C07-087
Repliconchromosome [GenBank: NC_020796] [Browse all T6SS(s) in this replicon]
Location [Strand]2614501..2617080 [+]
Producttype VI secretion system protein EvpH
NoteTssH
UniProt IDM4TJX8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.10E-39, Aligned region: 208..230
AAA_2 [PF07724], Evalue: 2.10E-39, Aligned region: 587..754
AAA [PF00004], Evalue: 1.00E-18, Aligned region: 208..338
AAA [PF00004], Evalue: 1.00E-18, Aligned region: 593..677
AAA_5 [PF07728], Evalue: 3.90E-14, Aligned region: 208..242
AAA_5 [PF07728], Evalue: 3.90E-14, Aligned region: 267..338
AAA_5 [PF07728], Evalue: 3.90E-14, Aligned region: 592..709
ClpB_D2-small [PF10431], Evalue: 2.60E-13, Aligned region: 764..834
AAA_16 [PF13191], Evalue: 1.10E-09, Aligned region: 185..229
AAA_16 [PF13191], Evalue: 1.10E-09, Aligned region: 252..287
AAA_16 [PF13191], Evalue: 1.10E-09, Aligned region: 418..512
AAA_16 [PF13191], Evalue: 1.10E-09, Aligned region: 586..637
AAA_16 [PF13191], Evalue: 1.10E-09, Aligned region: 657..681
AAA_16 [PF13191], Evalue: 1.10E-09, Aligned region: 734..783
Clp_N [PF02861], Evalue: 1.50E-09, Aligned region: 13..63
Clp_N [PF02861], Evalue: 1.50E-09, Aligned region: 96..121
Clp_N [PF02861], Evalue: 1.50E-09, Aligned region: 486..494
AAA_22 [PF13401], Evalue: 2.70E-09, Aligned region: 207..303
AAA_22 [PF13401], Evalue: 2.70E-09, Aligned region: 337..374
AAA_22 [PF13401], Evalue: 2.70E-09, Aligned region: 590..680
AAA_19 [PF13245], Evalue: 2.00E-05, Aligned region: 208..231
AAA_19 [PF13245], Evalue: 2.00E-05, Aligned region: 590..614
AAA_14 [PF13173], Evalue: 3.00E-05, Aligned region: 208..342
AAA_14 [PF13173], Evalue: 3.00E-05, Aligned region: 591..673
AAA_14 [PF13173], Evalue: 3.00E-05, Aligned region: 766..821
Sigma54_activat [PF00158], Evalue: 3.60E-05, Aligned region: 203..222
Sigma54_activat [PF00158], Evalue: 3.60E-05, Aligned region: 592..692
AAA_25 [PF13481], Evalue: 5.50E-05, Aligned region: 208..232
AAA_25 [PF13481], Evalue: 5.50E-05, Aligned region: 264..303
AAA_25 [PF13481], Evalue: 5.50E-05, Aligned region: 332..375
AAA_25 [PF13481], Evalue: 5.50E-05, Aligned region: 590..614
AAA_17 [PF13207], Evalue: 6.30E-05, Aligned region: 208..273
AAA_17 [PF13207], Evalue: 6.30E-05, Aligned region: 591..628
AAA_17 [PF13207], Evalue: 6.30E-05, Aligned region: 777..807
IstB_IS21 [PF01695], Evalue: 6.90E-05, Aligned region: 192..267
IstB_IS21 [PF01695], Evalue: 6.90E-05, Aligned region: 592..611
AAA_18 [PF13238], Evalue: 0.00013, Aligned region: 208..276
AAA_18 [PF13238], Evalue: 0.00013, Aligned region: 594..617
Zeta_toxin [PF06414], Evalue: 0.00014, Aligned region: 208..228
Zeta_toxin [PF06414], Evalue: 0.00014, Aligned region: 455..487
Zeta_toxin [PF06414], Evalue: 0.00014, Aligned region: 591..632
NACHT [PF05729], Evalue: 0.00017, Aligned region: 208..236
NACHT [PF05729], Evalue: 0.00017, Aligned region: 592..617
AAA_29 [PF13555], Evalue: 0.00099, Aligned region: 200..224
AAA_29 [PF13555], Evalue: 0.00099, Aligned region: 590..617
Hpr_kinase_C [PF07475], Evalue: 0.0026, Aligned region: 208..220
Hpr_kinase_C [PF07475], Evalue: 0.0026, Aligned region: 590..611
DUF815 [PF05673], Evalue: 0.0065, Aligned region: 202..283
DUF815 [PF05673], Evalue: 0.0065, Aligned region: 592..632
Arch_ATPase [PF01637], Evalue: 0.0094, Aligned region: 187..222
Arch_ATPase [PF01637], Evalue: 0.0094, Aligned region: 260..304
Arch_ATPase [PF01637], Evalue: 0.0094, Aligned region: 591..631
Arch_ATPase [PF01637], Evalue: 0.0094, Aligned region: 658..686
Protein Sequence: 859 a.a.     [Download]
>gi|470463477|ref|YP_007629788.1| type VI secretion system protein EvpH [Edwardsiella tarda C07-087]
MNQTCHQALEAAAGLCLARGHHEVDIEHVLLKLLETDNTDLARLLQHYGVDAGRFQRDIERALDRLKGGC
SRQPVLSPHLPRLLSGAWLMASVNCGESQIRSGHLIMALLDDAVLQQLARAMSPEWAAWSAADLLHQWPA
LVAGSREATTMSTPGPHAGASPSPALDQYTVNLSERARQGQLDPVLGRDSEIRQMIDILLRRRQNNPILT
GEAGVGKTAVVEGLALRIAAGEVPDSLRSVALRMLDLGLLQAGASVKGEFERRLKAVIDEVKACSEPVIL
FIDEAHTLIGAGGAAGQNDAANLLKPALARGELRTIAATTWSEYKKYFEKDPALARRFQAIKVEEPSEEI
AMVMLRGMLTKMRQHHQVRILDEAVTAAVRLSHRYLTGRQLPDKAVSVLDTACARIALGQRTLPAPVEDA
CRHLEHLQTEITLLEQEQASGLDHGRRLETLQEQARVAREHYQTLEQRWIAECDQVAVIQALQAQLEQED
GPARAEGLTQLEQAVLALEQMQGRAPLVQTCVDESAIAAVISAWTGIPLGKMVQDELEMVRQLQTRLAER
VIGQPYALETIARGIRLSRAGLEDPNKPIGVFLLVGSSGVGKTETALALAETLYGGERNLITINLSEFQE
AHTVSTLRGSPPGYVGYGEGGVLTEAVRRKPYSVVLLDEVEKAHPDVLELFFQVFDKGVMDDAEGREINF
RNTVILLTSNVGSDTLMAYCQDGMTPPEPALLCEALRDELIQTFKPAFLGRLQVVPYYPVRGAVLKQIIR
LKLDKIARRFQRNHQATFHYDEALVEGIAERCTQPESGARLIDNILSAQLLSDMADAVLARMAAGEPVSD
ITVSMDEHGRLTGSLEGSD
 
Nucleotide Sequence: 2580 bp     [Download]
>gi|470461182|ref|NC_020796.1|:2614501-2617080 Edwardsiella tarda C07-087, complete genome
ATGAACCAGACCTGCCATCAGGCGCTGGAGGCAGCGGCGGGCCTGTGCCTGGCGCGGGGCCATCACGAGG
TCGATATCGAGCACGTGCTGCTCAAGCTGCTGGAGACCGACAACACGGATCTGGCGCGCCTGCTGCAGCA
CTATGGGGTCGACGCCGGCCGTTTTCAGCGGGACATTGAGCGGGCGCTGGATCGCCTGAAGGGCGGATGC
AGCCGGCAGCCGGTGCTCTCCCCCCACCTGCCGCGGCTGCTGTCTGGTGCCTGGCTGATGGCCTCCGTCA
ACTGTGGCGAGAGCCAGATCCGCAGCGGTCATCTGATCATGGCGCTGCTGGATGACGCGGTGCTGCAGCA
GCTCGCCAGGGCGATGTCGCCCGAGTGGGCGGCGTGGTCAGCGGCAGATCTGCTGCACCAGTGGCCCGCG
CTGGTCGCGGGCAGTCGAGAGGCGACGACGATGAGCACGCCGGGGCCGCACGCGGGTGCATCTCCCTCGC
CCGCCCTGGATCAATACACGGTAAACCTGAGCGAGCGGGCCCGCCAGGGCCAGCTGGACCCGGTTCTCGG
GCGGGATAGCGAGATTCGGCAGATGATCGATATTTTGCTGCGCCGCAGGCAGAACAACCCGATTCTTACC
GGTGAGGCCGGCGTAGGGAAAACCGCCGTGGTTGAGGGGCTGGCCCTGCGCATTGCGGCCGGCGAGGTGC
CGGATAGCCTGCGCAGCGTTGCCCTGCGGATGCTGGATCTGGGCCTGCTGCAGGCGGGCGCCAGCGTCAA
GGGTGAGTTCGAGCGGCGTCTCAAGGCGGTCATCGACGAGGTGAAGGCCTGCAGTGAGCCGGTCATCTTG
TTCATCGATGAAGCCCATACGCTGATCGGCGCGGGAGGCGCGGCGGGTCAGAATGATGCCGCCAATCTGC
TGAAGCCGGCGCTGGCCCGCGGTGAGCTGCGCACCATTGCCGCCACCACCTGGAGCGAGTACAAAAAATA
TTTCGAGAAAGATCCCGCCCTGGCGCGGCGCTTCCAGGCCATCAAGGTGGAGGAGCCCAGCGAGGAGATC
GCCATGGTGATGCTGCGCGGCATGCTGACCAAAATGCGCCAGCACCACCAGGTCCGGATTCTGGATGAGG
CGGTGACGGCCGCCGTCAGGCTGTCACACCGCTATTTGACCGGCAGACAGCTGCCGGACAAGGCGGTCAG
CGTGCTGGATACCGCCTGCGCCCGCATTGCGCTCGGGCAGCGCACCCTGCCGGCCCCCGTCGAGGATGCC
TGCCGCCATCTGGAGCATCTCCAGACCGAGATCACGCTGCTGGAGCAGGAGCAGGCCAGCGGCCTCGATC
ATGGTCGCCGCCTGGAGACGCTGCAGGAGCAGGCCCGGGTCGCCCGGGAGCACTATCAGACCCTGGAGCA
GCGCTGGATCGCGGAGTGTGATCAGGTCGCCGTCATTCAGGCGCTGCAAGCGCAGCTGGAGCAGGAGGAT
GGCCCGGCGCGCGCTGAGGGGCTGACCCAGCTGGAGCAGGCCGTTTTGGCGCTTGAGCAGATGCAGGGCC
GGGCGCCGCTGGTGCAGACCTGTGTGGATGAGTCCGCCATTGCGGCGGTGATCTCGGCATGGACGGGGAT
TCCGCTGGGCAAGATGGTTCAGGATGAGCTGGAGATGGTTCGCCAGCTGCAGACGCGGCTGGCCGAGCGG
GTCATCGGGCAGCCCTATGCCCTGGAGACCATCGCCCGGGGGATTCGCCTGTCCCGCGCGGGGCTCGAGG
ATCCCAACAAGCCCATCGGCGTGTTTCTGCTGGTCGGCTCCAGCGGTGTAGGAAAGACCGAGACCGCGCT
GGCGCTGGCCGAAACCCTGTATGGCGGCGAGCGCAACCTGATCACCATCAACCTGTCGGAGTTTCAGGAG
GCCCATACCGTTTCGACGCTGCGGGGCTCGCCGCCGGGCTACGTCGGCTACGGAGAGGGCGGCGTGCTGA
CGGAGGCGGTACGCCGCAAACCCTACAGCGTGGTGCTGCTGGATGAGGTGGAGAAAGCCCACCCGGATGT
CCTGGAGCTGTTCTTCCAGGTGTTTGACAAGGGGGTCATGGACGATGCCGAGGGGCGGGAGATCAACTTC
CGCAATACCGTCATACTGCTGACCTCCAACGTCGGCAGCGACACCCTGATGGCCTACTGTCAGGACGGCA
TGACGCCGCCCGAACCGGCGCTGCTGTGTGAGGCGCTGCGGGATGAGCTGATCCAGACCTTCAAGCCGGC
CTTCCTCGGACGCCTGCAGGTAGTGCCCTACTACCCGGTGCGGGGCGCGGTGCTAAAACAGATTATCCGC
CTCAAGCTGGATAAGATTGCCCGCCGCTTCCAGCGCAATCATCAGGCCACCTTCCATTACGATGAGGCCC
TGGTGGAGGGCATCGCCGAGCGCTGTACCCAGCCGGAGAGCGGCGCCCGCCTGATCGATAACATTCTGTC
GGCCCAGCTGCTGTCCGATATGGCGGACGCGGTGCTGGCGCGCATGGCCGCCGGTGAGCCGGTGTCCGAT
ATCACCGTCTCAATGGATGAGCACGGCCGACTGACGGGATCGTTAGAGGGGAGTGACTGA