SecReT6
Protein ID: 470463478
SecReT6 ID739
T6SS typei4b
Gene symbol-
Locus tagETAC_11540
StrainEdwardsiella tarda C07-087
Repliconchromosome [GenBank: NC_020796] [Browse all T6SS(s) in this replicon]
Location [Strand]2617080..2619065 [+]
Producttype VI secretion system protein EvpI
NoteTssI
UniProt IDM4TKK0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.60E-79, Aligned region: 29..330
Phage_GPD [PF05954], Evalue: 7.60E-79, Aligned region: 360..378
Phage_base_V [PF04717], Evalue: 8.90E-24, Aligned region: 199..218
Phage_base_V [PF04717], Evalue: 8.90E-24, Aligned region: 366..458
Protein Sequence: 661 a.a.     [Download]
>gi|470463478|ref|YP_007629789.1| type VI secretion system protein EvpI [Edwardsiella tarda C07-087]
MGLTSDSRLLSLSTPLGKDALQVVQCRGEEAIADLYRFELELFSTDPALAWQSLVGQAAALRLALPNGQT
RYWHGVIGRAAYRGAEQHGFAYYAELVPRLAWLQHAQECQIFQEKTVPQIIEAVLKARGISDFRLSLSQR
YAPREYCVQYRESDLSFISRLMEEEGIFYWFEHSESRHVLVLADGNAAVQPCKVRSDIVYRPKHRSESGD
DIQWWMPSLAVVPANVFLNAYTFEQPTAHLLTSSASVAKQGKLSDVAVYDFTDDYTQTREGERRAKLKME
GLEAMQARIEGGGRCRTLAPGYGFSLQKHFRKDCNGDYLLLSVRHEIVNNLPWQEQEVNYQNHFICLPKS
LPYRTLSQTPRPVIHGVQTAVVTGPQGEEIHTDRHGRVKVHFHWDRLGTQDDKSSCWIRVAQGWAGLGWG
GMQLPRVGQEVIVDFVDGNPDAPLITGRVYNAHQTPPFKLPDNKTQSGIQTRSTPNGNPEHFSLLRFEDK
MGAEEVFMQAERDFRRRVKHDDELTVEHDRRVTIKNDCAETVSEGNYLQSITKGKHTRVIEGDALTEVKS
GNSTLQVNKGDHATTASAGSLHLKAGTAITLSVGSNRIVIDSGGVLIEGMNITVKGKQSIALSGLSVAIT
GTQSASLSSSAEAEVSSSVMTSIKGGIVKIN
 
Nucleotide Sequence: 1986 bp     [Download]
>gi|470461182|ref|NC_020796.1|:2617080-2619065 Edwardsiella tarda C07-087, complete genome
ATGGGATTAACGTCGGATAGCCGGCTGTTGTCCTTGTCCACCCCGCTGGGCAAGGATGCCTTACAGGTGG
TGCAGTGCCGGGGCGAAGAGGCGATCGCCGATCTCTACCGCTTTGAGCTGGAGCTGTTCTCCACGGACCC
CGCGCTGGCGTGGCAATCGCTGGTCGGGCAGGCCGCCGCGCTGCGGCTGGCCCTGCCGAATGGCCAGACC
CGCTACTGGCATGGCGTGATCGGCCGGGCCGCCTACCGGGGCGCCGAGCAACACGGATTTGCCTATTATG
CCGAGCTGGTACCGCGCCTGGCCTGGCTGCAGCACGCCCAGGAGTGTCAGATCTTCCAGGAGAAGACGGT
CCCGCAGATTATTGAAGCGGTGCTTAAGGCGCGGGGCATCAGCGATTTTCGCCTCTCGCTGTCGCAGCGC
TACGCCCCCCGGGAATACTGCGTACAGTATCGCGAATCGGACCTCAGCTTCATCAGCCGACTGATGGAGG
AAGAGGGCATTTTCTACTGGTTCGAACACAGCGAAAGCCGCCATGTGCTGGTATTGGCCGATGGCAATGC
CGCGGTCCAACCCTGCAAGGTGCGCTCAGACATCGTCTATCGACCTAAGCATAGGAGCGAATCCGGCGAT
GATATCCAGTGGTGGATGCCCTCCCTCGCGGTCGTGCCGGCCAACGTCTTCCTGAATGCCTATACCTTTG
AGCAGCCGACCGCCCATTTGCTGACCTCCAGCGCCTCCGTGGCCAAGCAGGGCAAATTGAGCGACGTGGC
GGTCTACGATTTCACCGATGACTATACGCAGACCCGGGAGGGCGAACGCCGCGCCAAGCTGAAGATGGAG
GGGCTAGAGGCCATGCAGGCCCGGATAGAGGGCGGCGGACGCTGCCGCACGCTGGCGCCGGGCTATGGGT
TCAGCCTGCAAAAACATTTCCGCAAAGACTGTAACGGTGACTATCTGCTGCTAAGCGTACGGCACGAGAT
CGTCAACAACCTGCCGTGGCAGGAGCAAGAGGTGAACTACCAGAACCACTTTATCTGTCTCCCCAAATCC
CTGCCCTACCGCACCCTGAGCCAAACGCCCCGCCCGGTGATCCATGGCGTACAGACTGCCGTGGTCACCG
GTCCGCAGGGCGAGGAGATCCATACCGATCGGCATGGACGGGTTAAGGTTCATTTTCACTGGGATCGCCT
GGGAACGCAGGATGATAAAAGCTCCTGCTGGATCCGGGTGGCGCAGGGCTGGGCCGGGCTGGGCTGGGGG
GGGATGCAGCTGCCCCGCGTAGGGCAGGAGGTGATCGTGGATTTTGTCGATGGCAATCCGGACGCCCCCC
TGATCACCGGCCGGGTCTATAACGCCCACCAGACGCCCCCCTTCAAGCTGCCTGACAATAAGACCCAAAG
CGGCATTCAGACCCGCAGCACCCCCAATGGCAATCCGGAGCACTTCAGCCTGCTGCGCTTCGAGGACAAG
ATGGGGGCGGAAGAGGTGTTCATGCAGGCGGAGCGGGATTTTCGCCGCCGGGTGAAACACGATGACGAGC
TGACGGTCGAGCACGACCGCCGGGTAACCATCAAGAATGACTGCGCCGAGACGGTCTCCGAGGGGAACTA
CCTGCAGAGCATCACCAAGGGCAAGCATACCCGGGTGATCGAGGGCGATGCCCTCACGGAGGTGAAGTCA
GGCAACAGTACGCTGCAGGTGAACAAGGGGGATCACGCCACCACCGCCTCGGCGGGCAGCCTCCATCTGA
AGGCAGGAACCGCGATCACCCTGAGCGTGGGCAGCAACCGTATCGTCATTGACAGCGGCGGCGTGCTCAT
CGAGGGCATGAATATCACGGTGAAGGGGAAACAGTCCATTGCGCTATCCGGCCTCAGCGTCGCGATAACG
GGCACCCAATCGGCCAGCCTGAGCAGTTCGGCAGAGGCGGAGGTCTCCTCGTCCGTGATGACCTCCATCA
AGGGCGGCATTGTCAAGATCAACTGA