SecReT6
Protein ID: 470463479
SecReT6 ID739
T6SS typei4b
Gene symbol-
Locus tagETAC_11545
StrainEdwardsiella tarda C07-087
Repliconchromosome [GenBank: NC_020796] [Browse all T6SS(s) in this replicon]
Location [Strand]2619206..2619463 [+]
Producttype VI secretion system protein EvpJ
NotePAAR
UniProt IDM4U1U2
KEGG IDetc:ETAC_11545
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 1.80E-22, Aligned region: 9..75
DUF4150 [PF13665], Evalue: 4.40E-06, Aligned region: 20..39
DUF4150 [PF13665], Evalue: 4.40E-06, Aligned region: 44..73
Protein Sequence: 85 a.a.     [Download]
>gi|470463479|ref|YP_007629790.1| type VI secretion system protein EvpJ [Edwardsiella tarda C07-087]
MQTPGVPPVPHVGGPVIGPGVPTVLIGGLPAAVLGDMLTCVGPPDTIIKGSATVLIGGKPAARMGDSTAH
GGTITLGCPTVLIGG
 
Nucleotide Sequence: 258 bp     [Download]
>gi|470461182|ref|NC_020796.1|:2619206-2619463 Edwardsiella tarda C07-087, complete genome
ATGCAGACCCCGGGCGTTCCCCCGGTGCCGCACGTCGGCGGCCCGGTCATCGGCCCCGGCGTTCCCACGG
TGCTGATCGGCGGACTGCCGGCGGCGGTGCTGGGCGACATGCTGACCTGCGTCGGCCCGCCCGACACCAT
TATCAAGGGCAGTGCCACCGTGCTGATCGGCGGCAAGCCCGCCGCCCGCATGGGGGACAGCACGGCGCAT
GGCGGCACGATCACGCTGGGCTGCCCCACCGTGTTGATTGGCGGCTAA