SecReT6
Protein ID: 470463480
SecReT6 ID739
T6SS typei4b
Gene symbol-
Locus tagETAC_11550
StrainEdwardsiella tarda C07-087
Repliconchromosome [GenBank: NC_020796] [Browse all T6SS(s) in this replicon]
Location [Strand]2619477..2620544 [+]
Producttype VI secretion system protein EvpK
NoteTssA
UniProt IDM4TMB8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.40E-23, Aligned region: 56..116
ImpA-rel_N [PF06812], Evalue: 1.40E-23, Aligned region: 237..252
Herpes_UL17 [PF04559], Evalue: 0.0041, Aligned region: 158..253
Protein Sequence: 355 a.a.     [Download]
>gi|470463480|ref|YP_007629791.1| type VI secretion system protein EvpK [Edwardsiella tarda C07-087]
MTILDMARLLAPIGEAHPAGEDISFDPLYDQIREARRADADYLGQGEWVSSLKQANWVEVIRLTSEALAT
RSKDLQLAVWLCEALVQRHGLPGLREGLLLLDSLLERYWAEMYPALSDGDLEGRVSRLEWLNQILPPALG
LLPLTAAQDGRAYGWLDWQVSREVDNLKRLNSEAAQAALSEGKLDPDAWDLAVSHTPGAFYLTLQDDLQQ
AIRAFQGLSQRLDPLFGRDAPRISDVAERLEQMLRLVTRLVEGKGVARPREAQERAEAPAGAETAAVNAS
SPGVAGAPRTREEAIRQLSGIAAFFKETEPHSPVSYIVDKAARWGNMRLDEWIREVVEDDGTRRMLKGVL
GYDEE
 
Nucleotide Sequence: 1068 bp     [Download]
>gi|470461182|ref|NC_020796.1|:2619477-2620544 Edwardsiella tarda C07-087, complete genome
ATGACTATCTTAGATATGGCGCGCTTGCTGGCCCCGATCGGTGAAGCTCATCCGGCGGGAGAGGATATCA
GCTTCGACCCGCTGTATGACCAGATTCGGGAGGCCCGCCGGGCCGATGCCGACTACCTTGGGCAGGGAGA
GTGGGTCAGCTCGCTCAAGCAGGCCAACTGGGTCGAGGTGATCCGCCTGACCAGCGAGGCGCTGGCGACG
CGCAGCAAAGATCTGCAGCTGGCGGTGTGGCTGTGCGAAGCCCTGGTGCAGCGGCATGGGCTGCCGGGGC
TGCGCGAGGGGCTGCTGTTGCTGGATAGCCTGCTGGAGCGCTATTGGGCGGAGATGTATCCGGCGCTGAG
CGACGGGGATCTGGAGGGGCGGGTGAGCCGTCTGGAGTGGCTCAATCAGATCCTTCCCCCGGCGCTGGGC
TTGCTGCCCCTGACGGCCGCCCAGGATGGACGCGCCTACGGCTGGCTGGATTGGCAGGTCTCCCGAGAGG
TCGATAACCTGAAGCGGCTGAACAGTGAGGCGGCTCAGGCGGCCCTCAGCGAAGGAAAGCTGGATCCGGA
TGCCTGGGATCTCGCCGTCAGCCATACGCCCGGCGCCTTTTACCTGACGTTACAGGACGATCTGCAGCAG
GCCATCCGCGCATTCCAGGGATTATCCCAGCGGCTCGACCCCCTATTTGGGCGGGATGCCCCGCGGATCA
GCGATGTGGCTGAGCGGCTGGAGCAGATGCTCAGGCTGGTGACGCGGCTGGTAGAGGGTAAGGGCGTGGC
GCGACCCCGCGAGGCCCAGGAGCGCGCAGAGGCGCCGGCGGGCGCAGAGACCGCCGCGGTTAACGCTTCC
TCTCCCGGCGTGGCCGGCGCCCCCCGAACCCGCGAGGAGGCCATTCGGCAGCTCAGCGGCATCGCCGCGT
TTTTCAAGGAGACCGAACCGCACAGCCCCGTCTCCTACATCGTGGATAAAGCCGCCCGCTGGGGCAATAT
GCGACTGGATGAGTGGATCCGAGAGGTGGTGGAAGATGACGGCACCCGGCGGATGCTCAAAGGTGTATTG
GGCTATGATGAAGAATAA