SecReT6
Protein ID: 470463481
SecReT6 ID739
T6SS typei4b
Gene symbol-
Locus tagETAC_11555
StrainEdwardsiella tarda C07-087
Repliconchromosome [GenBank: NC_020796] [Browse all T6SS(s) in this replicon]
Location [Strand]2620531..2621172 [+]
Producttype VI secretion system protein EvpL
NoteTssJ
UniProt IDM4TNT6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.20E-19, Aligned region: 16..177
Protein Sequence: 213 a.a.     [Download]
>gi|470463481|ref|YP_007629792.1| type VI secretion system protein EvpL [Edwardsiella tarda C07-087]
MMKNKAIWSAIGCLLLSLSGCTSDAAKQQARSSVSWRYGSQAILVNAQTAPDLNSYDGESHSLVLAVVQT
RSPDAFYQLIQTPELAGLVLQGGRPPDGILQVSRYALEPGHAFRLVLDRLQEARQVGFIAAFYGLPLTQT
SRLFDIPVSVTRSGILFPDWQAAPSPLALDLKLGNSGIGEAESHPLERIPAAPDPASAPTAATPIRLSDS
GEP
 
Nucleotide Sequence: 642 bp     [Download]
>gi|470461182|ref|NC_020796.1|:2620531-2621172 Edwardsiella tarda C07-087, complete genome
ATGATGAAGAATAAGGCGATCTGGAGTGCCATCGGCTGCCTGCTGCTCAGCCTGAGCGGCTGCACCTCCG
ACGCGGCAAAGCAGCAGGCCCGCAGCAGCGTATCCTGGCGGTACGGCAGCCAGGCCATCTTGGTGAATGC
ACAAACCGCCCCGGATCTGAACAGCTACGACGGCGAGTCGCACAGCCTGGTGCTGGCGGTGGTGCAGACT
CGCTCGCCGGACGCCTTCTATCAGTTAATCCAAACCCCCGAACTCGCCGGCCTCGTCTTGCAGGGCGGGC
GTCCCCCTGACGGAATTTTGCAGGTAAGCCGCTATGCCCTGGAGCCCGGCCACGCTTTCCGCCTGGTCCT
GGATCGCCTGCAGGAGGCGCGCCAGGTGGGGTTCATCGCCGCGTTCTACGGCCTGCCGCTAACGCAGACC
TCCCGCCTGTTTGATATCCCGGTCAGCGTGACCCGCTCGGGGATACTGTTCCCGGACTGGCAAGCCGCCC
CCTCCCCCCTGGCGCTGGACCTGAAGCTGGGGAACAGCGGGATCGGCGAGGCGGAGAGCCATCCGCTGGA
GCGCATTCCCGCGGCCCCCGATCCGGCCAGCGCGCCGACGGCGGCTACGCCGATCCGGCTGAGCGATAGC
GGCGAACCCTAG