SecReT6
Protein ID: 470463482
SecReT6 ID739
T6SS typei4b
Gene symbol-
Locus tagETAC_11560
StrainEdwardsiella tarda C07-087
Repliconchromosome [GenBank: NC_020796] [Browse all T6SS(s) in this replicon]
Location [Strand]2621307..2622659 [+]
Producttype VI secretion system protein EvpM
NoteTssK
UniProt IDM4TJY3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 5.70E-90, Aligned region: 7..448
Protein Sequence: 450 a.a.     [Download]
>gi|470463482|ref|YP_007629793.1| type VI secretion system protein EvpM [Edwardsiella tarda C07-087]
MFLQPQHFQLADLHSQFQLKPFLDSGLQDFWGVGALTISESALGNQQLNILSAELLFRDHSYVVWPGNTI
CKPRSFASAWQDQSRPFNVYLGLKKLDTIESNVAVVPQLEDGAGRNVRCVTTQQGDKHADLYSDGPEAEI
QSLHYVLQVLWESEVEKLTDYNILPIARLERQGEVVQLSKSFIPPCYIMGGSETLMRVVRDVRDDLAGRA
RQLEAYKSPREIRKAEFDASFLMFLLALRTLNRYVPLLYQLTESPQVHPRKVYDVLRQIVGELSTFSERC
DMLGSSGENSPGLPPYRHQDIAPGLLTVRDLIIRLLNEISIGPDFLIALEPSGEYLTARLPKSLLEDRNR
FYLIVRSDMAPDTLQAAFRARARLAEADALPLLIQRALPGITLTPLSSVPEGLPRRSCSFYFQIDTQSEA
WRQVAESCHVAFNWFDAPDDLKVELVGVSR
 
Nucleotide Sequence: 1353 bp     [Download]
>gi|470461182|ref|NC_020796.1|:2621307-2622659 Edwardsiella tarda C07-087, complete genome
ATGTTTTTACAGCCGCAGCATTTTCAGCTGGCAGACCTGCATAGCCAATTTCAGCTCAAGCCATTCTTGG
ACTCCGGACTGCAGGATTTTTGGGGAGTGGGAGCGCTGACCATTTCGGAGTCAGCCCTAGGCAACCAGCA
GCTCAATATCCTGTCGGCTGAGCTGCTCTTCCGCGACCACAGCTATGTCGTATGGCCGGGCAACACCATC
TGTAAGCCGCGCTCCTTCGCCTCTGCCTGGCAGGATCAGAGCCGGCCGTTCAATGTCTACCTGGGGCTGA
AAAAGCTGGACACGATAGAGTCCAATGTGGCCGTCGTGCCACAGCTTGAGGATGGCGCAGGGCGGAACGT
CCGCTGCGTGACGACCCAGCAGGGAGACAAGCACGCGGACTTATATTCGGATGGGCCTGAAGCCGAGATC
CAGAGCCTGCACTACGTGCTGCAGGTGCTGTGGGAGAGCGAGGTTGAAAAGCTGACGGATTACAATATCC
TGCCCATCGCCCGGCTGGAGCGCCAGGGCGAGGTGGTTCAGCTGTCCAAGAGCTTCATTCCGCCGTGCTA
CATCATGGGCGGCTCCGAGACCCTGATGCGGGTGGTCCGGGATGTCCGGGACGATCTGGCGGGGCGCGCC
CGCCAGCTGGAGGCCTATAAAAGCCCGCGCGAAATCCGCAAGGCGGAGTTCGATGCCAGCTTTCTGATGT
TTCTGCTGGCCCTGCGCACCCTCAACCGCTACGTGCCGCTGCTGTACCAGCTGACCGAATCGCCGCAGGT
CCATCCGCGCAAGGTCTACGACGTGCTGCGGCAGATCGTCGGCGAGCTGTCCACCTTCAGCGAGCGCTGC
GACATGCTGGGCTCCAGCGGCGAAAACAGCCCGGGGCTCCCCCCCTACCGCCATCAGGACATCGCGCCGG
GGCTGTTAACCGTACGCGATCTGATTATTCGTTTATTGAATGAAATATCGATCGGACCCGATTTCCTGAT
CGCCCTGGAGCCGAGCGGGGAGTACCTGACGGCGCGGCTCCCCAAGAGCCTGCTGGAAGATCGTAACCGC
TTCTACCTGATCGTCCGCAGTGACATGGCGCCGGATACCCTGCAGGCCGCCTTCCGGGCCCGCGCCAGGC
TGGCCGAGGCCGACGCATTGCCCTTACTGATCCAGCGCGCCTTGCCGGGGATCACGCTGACGCCGCTATC
GTCCGTTCCCGAAGGCTTGCCCCGGCGCTCCTGCTCGTTTTATTTCCAGATCGATACCCAAAGTGAAGCC
TGGCGGCAGGTCGCCGAGAGTTGCCACGTCGCGTTCAACTGGTTCGATGCCCCAGATGACCTCAAAGTAG
AATTGGTAGGAGTGAGCCGGTGA