SecReT6
Protein ID: 470463483
SecReT6 ID739
T6SS typei4b
Gene symbol-
Locus tagETAC_11565
StrainEdwardsiella tarda C07-087
Repliconchromosome [GenBank: NC_020796] [Browse all T6SS(s) in this replicon]
Location [Strand]2622656..2623306 [+]
Producttype VI secretion system protein EvpN
NoteTssL
UniProt IDM4TKK4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.90E-39, Aligned region: 2..204
Protein Sequence: 216 a.a.     [Download]
>gi|470463483|ref|YP_007629794.1| type VI secretion system protein EvpN [Edwardsiella tarda C07-087]
MSLSEAFIQPMLYVRQYLQAPEGEASLFRERLQSYLHHSQLRAQEAGESPAAIDSALYAVVAWMDETIMC
STWDGVATWRRDPLQASYFNTVCAGVDFFDKLTALSPEADDVREVYLLCLALGFEGRYAGPAGQTALTQI
RVHQLRDLHGEVWEASRRLFPEAYPRSSVTPTQQTRWLTQSRFTTVVVPLVILVALYGILNWVLYEYADL
ALEWLP
 
Nucleotide Sequence: 651 bp     [Download]
>gi|470461182|ref|NC_020796.1|:2622656-2623306 Edwardsiella tarda C07-087, complete genome
GTGAGTTTATCGGAAGCGTTTATTCAGCCCATGCTCTACGTGCGGCAGTATCTCCAGGCGCCCGAAGGCG
AGGCGTCATTATTCCGTGAGCGGCTGCAGTCATACCTGCACCACAGCCAGCTCCGGGCCCAAGAGGCGGG
GGAAAGTCCGGCCGCGATCGACTCCGCCCTGTATGCCGTTGTGGCCTGGATGGATGAGACCATCATGTGT
TCGACGTGGGACGGCGTGGCGACATGGCGACGTGACCCCCTGCAGGCCAGCTACTTCAACACCGTCTGCG
CCGGGGTTGACTTCTTCGACAAGCTGACCGCCCTGAGCCCCGAGGCCGATGACGTCAGGGAGGTCTATCT
GCTGTGCCTGGCCCTGGGATTTGAGGGGCGCTATGCCGGCCCGGCGGGCCAGACCGCGCTGACGCAGATC
AGGGTGCACCAGCTGAGGGATCTGCACGGCGAGGTATGGGAGGCGTCGCGGCGTTTATTTCCAGAGGCCT
ACCCGAGATCCTCGGTCACGCCGACGCAGCAAACGCGATGGCTGACCCAAAGCCGCTTTACCACCGTCGT
CGTGCCGCTGGTCATCCTGGTCGCCCTGTACGGCATTTTAAACTGGGTATTATATGAATACGCGGATCTC
GCGCTGGAGTGGCTGCCATGA