SecReT6
Protein ID: 470473919
SecReT6 ID740
T6SS typei3
Gene symbol-
Locus tagXAC29_20715
StrainXanthomonas axonopodis Xac29-1
Repliconchromosome [GenBank: NC_020800] [Browse all T6SS(s) in this replicon]
Location [Strand]4798864..4799907 [-]
Producthypothetical protein
NoteTssA
UniProt IDM4TZH1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.70E-21, Aligned region: 56..116
Protein Sequence: 347 a.a.     [Download]
>gi|470473919|ref|YP_007638487.1| hypothetical protein XAC29_20715 [Xanthomonas axonopodis Xac29-1]
MQDDSSLETLLAPLGDDAPAGPDLEYDPEFLRLERESAVRAERALGESVIAAEEPDWDKVQALALDLCRR
SRDLRVAGRLGAAWLRLRGLPGWADALALIHGLLERHWDSVHPQLDADDDNDPTSRINALVGLSDPMGLL
GALRATAFVQSPRLGRFSLRDLRVANGSIKLPDGQSGPSLAEIEACCQDCTPETLATSAQAITEALRQAR
AIDALLSERVGTAAPDLRPLLTDLRDLERFVLPHWQARQGISAIAEDGEQAAGEGHAVAMATNATCRNDE
IAGPDDVKRRLEEICAYYARHEPSSPVPMLLRRAQRLVGADFLALMKELAPAGIDELQRVTGPLEDS
 
Nucleotide Sequence: 1044 bp     [Download]
>gi|470469929|ref|NC_020800.1|:c4799907-4798864 Xanthomonas axonopodis Xac29-1, complete genome
ATGCAAGACGACAGTTCCCTGGAGACCCTGCTGGCGCCGCTCGGCGACGACGCCCCGGCCGGACCGGATC
TGGAATACGACCCGGAGTTCCTGCGCCTGGAGCGCGAATCGGCGGTCCGCGCCGAGCGCGCGCTGGGCGA
GAGCGTCATCGCCGCCGAAGAACCGGACTGGGACAAGGTACAGGCGCTGGCGCTGGACCTGTGCCGGCGT
AGCCGCGACTTGCGCGTGGCCGGCAGGCTCGGCGCCGCCTGGCTGCGCCTGCGCGGCCTGCCGGGCTGGG
CCGACGCGCTGGCGTTGATCCATGGCCTGCTTGAGCGCCATTGGGACAGCGTGCATCCGCAACTGGATGC
CGACGACGACAACGACCCGACCTCGCGCATCAATGCGCTGGTCGGTCTTAGCGACCCGATGGGCCTGCTC
GGCGCGCTGCGCGCCACCGCGTTCGTGCAGTCGCCGCGGCTGGGCCGCTTCAGCCTGCGCGATCTACGCG
TGGCCAATGGCAGCATCAAGCTGCCCGACGGCCAGAGCGGCCCCAGCCTGGCCGAAATCGAAGCCTGCTG
CCAGGACTGCACGCCGGAAACGCTGGCCACCTCCGCCCAGGCCATTACCGAAGCGCTGCGGCAGGCGCGC
GCGATCGATGCGCTGCTGAGCGAACGTGTCGGCACCGCCGCCCCTGACTTGCGCCCGCTACTGACCGACC
TGCGCGATCTGGAGCGCTTCGTGCTGCCGCACTGGCAAGCGCGGCAGGGCATCTCGGCGATCGCCGAAGA
CGGCGAGCAGGCTGCCGGCGAAGGCCACGCCGTCGCCATGGCAACCAACGCCACGTGCCGCAACGACGAG
ATCGCCGGCCCCGATGATGTGAAGCGGCGGCTGGAAGAGATCTGCGCCTATTACGCCCGGCACGAACCGT
CCAGCCCGGTGCCGATGCTGCTGCGCCGCGCGCAACGCCTGGTCGGCGCCGATTTCCTGGCCCTGATGAA
GGAGCTGGCCCCGGCCGGCATCGACGAACTGCAACGCGTCACCGGCCCGCTGGAAGACAGCTAA