SecReT6
Protein ID: 470473926
SecReT6 ID740
T6SS typei3
Gene symbol-
Locus tagXAC29_20750
StrainXanthomonas axonopodis Xac29-1
Repliconchromosome [GenBank: NC_020800] [Browse all T6SS(s) in this replicon]
Location [Strand]4817751..4819031 [-]
Producthypothetical protein
NoteTssL
UniProt IDM4UGJ7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.50E-69, Aligned region: 47..251
DUF2077 [PF09850], Evalue: 4.50E-69, Aligned region: 375..416
OmpA [PF00691], Evalue: 2.70E-11, Aligned region: 317..406
Protein Sequence: 426 a.a.     [Download]
>gi|470473926|ref|YP_007638494.1| hypothetical protein XAC29_20750 [Xanthomonas axonopodis Xac29-1]
MGDPELSMSRPVADLAPAYAAPLPAAGGTGVPSEDTDISELLGRSVNPLVQAATPLLLLAVQLRHSAQSP
DVARLREQVMAQVRRFEHRARDGGAPVEAVTAARYVLCALLDEAVLNAPWGERSGWSQKTLLVTFHSESY
GGAKFFQILERLCADMPRHLDLIELMYLCLALGFVGRYQIEAGGIATLAAIQEDVYRRIRAARGPAPDSL
APRWRGVEDRRRLGRYLPVWAAALLGLSLVVVAFVWLQARLNSLSAPISAQAAQWGIAPATPPDAAPVPP
PPVRLKQLLSAQERAGLLRVDEQADGQTRVRLSSAAMFASGGVEVELQQRGLIAQIAAAIEQLPGRVIVV
GHTDDVPVRSLRFQDNYALSAARAQALAQVLQAQLSTPGRVEAIGAGASQPIAQPVQLPANRARNRRVEI
LFQPGE
 
Nucleotide Sequence: 1281 bp     [Download]
>gi|470469929|ref|NC_020800.1|:c4819031-4817751 Xanthomonas axonopodis Xac29-1, complete genome
GTGGGCGATCCGGAGCTGAGCATGAGCCGACCTGTTGCCGATCTGGCGCCAGCCTACGCCGCACCGCTGC
CGGCCGCAGGGGGCACCGGCGTGCCCAGCGAAGACACCGACATCAGCGAATTGCTGGGCCGCAGCGTCAA
CCCGTTGGTGCAGGCCGCCACGCCGCTGCTGCTGTTGGCGGTGCAGTTGCGCCACAGTGCGCAATCGCCC
GATGTGGCCCGCCTGCGCGAGCAGGTGATGGCGCAGGTGCGCCGCTTCGAACACCGTGCGCGCGATGGAG
GCGCGCCGGTGGAAGCGGTCACCGCCGCGCGCTACGTGTTGTGCGCGCTGCTGGACGAAGCGGTGCTCAA
CGCACCGTGGGGCGAGCGCAGCGGCTGGTCGCAGAAGACCTTGCTGGTGACCTTCCACAGCGAATCGTAC
GGCGGCGCCAAGTTCTTCCAGATCCTGGAGCGCTTGTGCGCCGATATGCCGCGGCATCTGGACTTGATCG
AGTTGATGTACCTGTGCCTGGCGCTGGGGTTCGTCGGCCGCTACCAGATCGAGGCCGGCGGCATCGCGAC
GCTGGCGGCCATCCAGGAGGATGTCTATCGCCGCATCCGTGCGGCGCGCGGCCCCGCGCCGGACAGCTTG
GCGCCGCGTTGGCGCGGGGTGGAAGACCGCCGCCGGCTGGGCCGTTATCTGCCGGTGTGGGCGGCTGCAT
TGCTGGGGTTGAGCCTGGTGGTGGTGGCGTTCGTGTGGTTGCAGGCGCGTTTGAACAGCCTGTCCGCACC
GATCAGTGCGCAGGCCGCCCAATGGGGAATTGCGCCGGCCACGCCGCCGGACGCTGCACCCGTGCCGCCG
CCTCCGGTGCGGCTCAAGCAGTTGCTCTCCGCGCAGGAACGCGCCGGCCTGCTGCGCGTGGACGAACAGG
CCGACGGGCAGACGCGCGTGCGCCTCAGCAGCGCGGCGATGTTCGCCTCCGGCGGGGTGGAGGTGGAGCT
GCAGCAGCGCGGCTTGATCGCGCAGATTGCAGCGGCCATCGAGCAATTGCCGGGGCGGGTGATCGTGGTC
GGGCACACCGATGACGTGCCGGTGCGCTCGCTGCGCTTCCAGGACAACTACGCCTTGTCGGCCGCGCGTG
CGCAGGCGCTTGCGCAGGTGTTGCAGGCGCAGCTGAGCACGCCGGGGCGGGTGGAAGCCATTGGCGCCGG
CGCTTCGCAACCGATCGCACAGCCGGTGCAATTACCGGCCAACCGCGCGCGCAACCGCCGCGTGGAGATC
TTGTTCCAGCCTGGGGAATGA