SecReT6
Protein ID: 470473927
SecReT6 ID740
T6SS typei3
Gene symbol-
Locus tagXAC29_20755
StrainXanthomonas axonopodis Xac29-1
Repliconchromosome [GenBank: NC_020800] [Browse all T6SS(s) in this replicon]
Location [Strand]4819013..4820410 [-]
Producthypothetical protein
NoteTssK
UniProt IDM4U1Q3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.30E-153, Aligned region: 39..464
Protein Sequence: 465 a.a.     [Download]
>gi|470473927|ref|YP_007638495.1| hypothetical protein XAC29_20755 [Xanthomonas axonopodis Xac29-1]
MRRGADACALHRWPTSLSECIMQNNKVVWSEGLFLRPQHLQQQERYLERYVDLRAARLRPHAWGVSELEW
ESDLLAVGKLGLRRARGVFADGTPFAMPGDDPLPVALEVEPNCRDQIVYLTVPLRVPAQPELGRPESPAD
QLFRYRVRETESNDASGSTSEAVLMEVGGLSTRLLPHSQPLEGLDRIAVARIIEMRADRQVVLDPHFIPS
AMVCQAAPRLTTFLTELLGLLHQRGEALASRVTLTDRGGAADIADFLLLQLVNRWQPQMAHWAAAPLAHP
EELFRALVALAGELSTFTAAGKRPPAWPAYRHQSQQDSFEPVIGALRSSLSAVLEQTATPLPIQARKFGV
WVAMVPDPGLLDSAAFVLAAKADMPSEELRRQLPAHAKIGPVEQIRDLVNLQLPGIVATPMPVAPRQIPY
HAGYLYFEFDKSAALWRTLKTSGGIAFHFGSEFAGLDLQLWAIRS
 
Nucleotide Sequence: 1398 bp     [Download]
>gi|470469929|ref|NC_020800.1|:c4820410-4819013 Xanthomonas axonopodis Xac29-1, complete genome
ATGCGACGCGGTGCGGATGCCTGTGCGCTGCATCGGTGGCCGACCTCCCTCAGCGAGTGCATCATGCAGA
ACAACAAGGTCGTGTGGAGCGAAGGGCTGTTCCTGCGCCCGCAGCATCTGCAGCAGCAAGAGCGCTACCT
GGAGCGCTACGTCGATCTGCGTGCCGCGCGATTGCGGCCGCATGCCTGGGGCGTGAGCGAGCTGGAATGG
GAGAGCGACCTGCTGGCGGTGGGCAAGCTGGGCCTGCGGCGCGCGCGTGGCGTGTTCGCCGATGGCACGC
CCTTCGCGATGCCGGGCGACGACCCGCTGCCGGTTGCGCTGGAGGTCGAGCCCAACTGCCGCGACCAGAT
CGTCTATCTCACCGTACCGCTGCGGGTGCCGGCGCAGCCCGAACTCGGGCGCCCGGAATCGCCGGCCGAT
CAGCTGTTTCGCTACCGCGTGCGCGAGACCGAAAGCAACGACGCCTCCGGCAGCACCAGCGAAGCGGTGT
TGATGGAAGTCGGCGGGTTGAGCACGCGGTTGCTGCCGCACTCGCAACCGTTGGAGGGGCTGGACCGCAT
CGCGGTGGCGCGCATCATCGAGATGCGCGCCGACCGTCAGGTGGTGCTGGACCCGCATTTCATTCCCAGC
GCGATGGTATGCCAGGCGGCGCCGCGCTTGACCACCTTTCTGACCGAGTTGCTCGGTCTGTTGCATCAGC
GCGGCGAAGCGCTGGCATCGCGCGTGACGCTGACCGATCGCGGCGGTGCGGCCGATATCGCAGACTTTCT
GCTGCTGCAGCTGGTCAACCGTTGGCAGCCGCAGATGGCGCACTGGGCGGCCGCGCCATTGGCGCATCCG
GAAGAGTTGTTTCGCGCCTTGGTGGCGCTGGCCGGTGAACTGAGCACGTTCACCGCTGCCGGCAAGCGCC
CGCCTGCATGGCCTGCCTATCGGCACCAATCGCAGCAGGACAGCTTCGAGCCGGTGATCGGCGCCTTGCG
CAGCAGTTTGAGCGCAGTGCTCGAACAGACCGCCACGCCGCTCCCGATCCAGGCGCGCAAGTTCGGCGTG
TGGGTGGCGATGGTGCCGGACCCGGGCCTGCTCGACAGCGCGGCGTTCGTGCTCGCGGCCAAGGCCGACA
TGCCCAGCGAAGAGTTGCGCCGGCAATTGCCCGCGCACGCCAAGATCGGGCCGGTGGAGCAGATTCGCGA
TCTGGTCAATCTGCAGTTGCCCGGCATCGTGGCCACGCCCATGCCGGTGGCGCCGCGACAGATTCCGTAT
CACGCCGGCTATCTGTATTTCGAATTCGACAAGAGCGCAGCGTTGTGGCGAACGCTGAAGACCTCCGGCG
GTATCGCATTCCACTTCGGCAGCGAATTCGCCGGGTTGGACCTGCAATTGTGGGCGATCCGGAGCTGA