SecReT6
Protein ID: 470473928
SecReT6 ID740
T6SS typei3
Gene symbol-
Locus tagXAC29_20760
StrainXanthomonas axonopodis Xac29-1
Repliconchromosome [GenBank: NC_020800] [Browse all T6SS(s) in this replicon]
Location [Strand]4820927..4822243 [-]
Producthypothetical protein
NoteFha
UniProt IDM4U321
KEGG IDxao:XAC29_20760
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.20E-15, Aligned region: 32..95
Protein Sequence: 438 a.a.     [Download]
>gi|470473928|ref|YP_007638496.1| hypothetical protein XAC29_20760 [Xanthomonas axonopodis Xac29-1]
MSSSQLILTVGGAQAAQFGASAQKRFAGTGGSIGRSDESDWVLAAPGVSRTHAVVRFLNGMYFIEDRSTN
GMSLNGTALTRADPSALSDGDRLQLDSFEIHVQVQSLAAAPTPAPAFDPLPDAMDDRTQVAPPPSTRRAP
SATACLDLLEFGTPPSARPAVDALLDDLLLSGAPGELDPLRLLDPSPAPARDASPSAWNQSNASHDHFRP
PASPDARATLPENWDMTLGDFAPPAPLPALAPMAAPVASPFAPPAAVSVATAPSAATTVPPELDRIFAIV
VDGVMDVLRARAEIKNTFRLPVTVIQRSENNPLKFAATAEDALQKLLAPPSASFLSGVPAFEDAFDDIRC
HQMAMLAGMRAAFDAMLFHFSPDRLEQEADAGGKRLGFGGKGRYWERYRDNFEQLRSDPDDCFRRLFGDE
FARAYEAQLARLKSARRH
 
Nucleotide Sequence: 1317 bp     [Download]
>gi|470469929|ref|NC_020800.1|:c4822243-4820927 Xanthomonas axonopodis Xac29-1, complete genome
GTGTCCAGTTCGCAGTTGATCCTCACCGTCGGCGGCGCGCAGGCCGCGCAGTTCGGCGCCAGCGCGCAGA
AGCGCTTTGCCGGCACCGGCGGCAGCATCGGCCGCTCCGACGAAAGCGATTGGGTCCTGGCCGCGCCCGG
TGTCTCGCGCACGCATGCGGTGGTGCGCTTTCTCAACGGGATGTATTTCATCGAGGACCGCAGCACCAAC
GGCATGTCGCTCAACGGCACTGCGCTGACGCGTGCGGACCCGTCCGCGCTCAGCGATGGCGACCGCCTGC
AGCTGGACAGCTTCGAGATCCATGTGCAGGTGCAATCGCTGGCTGCAGCCCCGACGCCGGCGCCGGCATT
CGACCCGCTGCCAGATGCGATGGACGACCGCACCCAGGTTGCGCCGCCGCCGTCGACGCGGCGTGCCCCC
TCCGCCACAGCGTGCCTGGATCTGCTGGAGTTCGGTACGCCGCCTTCTGCGCGGCCTGCAGTGGACGCGT
TGTTGGACGATCTGCTGCTGAGCGGCGCACCCGGCGAGCTGGATCCGTTGCGCCTGCTCGACCCGTCGCC
TGCACCGGCACGCGATGCCAGCCCCAGCGCGTGGAATCAGAGCAACGCCAGCCACGACCATTTCCGTCCA
CCGGCCAGTCCCGATGCGCGCGCCACCTTGCCGGAAAACTGGGACATGACGCTTGGCGATTTTGCGCCGC
CCGCGCCATTGCCTGCGTTAGCGCCCATGGCCGCGCCGGTGGCCTCGCCATTCGCGCCGCCGGCGGCGGT
GTCGGTTGCAACCGCACCATCGGCGGCAACAACAGTGCCGCCGGAGCTGGATCGCATCTTCGCCATCGTG
GTCGATGGCGTCATGGATGTGCTGCGTGCACGCGCAGAGATCAAGAACACCTTTCGCTTGCCGGTCACGG
TGATCCAACGCTCGGAGAACAACCCGCTCAAGTTCGCCGCCACCGCCGAAGATGCGCTGCAGAAGTTGCT
CGCACCGCCAAGCGCGTCGTTTCTGTCCGGGGTGCCAGCGTTCGAAGATGCCTTCGACGATATCCGCTGC
CATCAGATGGCGATGCTGGCCGGCATGCGCGCGGCCTTCGACGCCATGCTGTTCCACTTCAGCCCGGACC
GCCTGGAGCAGGAAGCCGACGCCGGCGGTAAGCGCCTGGGTTTCGGTGGCAAGGGGCGTTACTGGGAACG
CTACCGCGACAATTTCGAGCAGCTGCGCAGCGACCCGGACGACTGCTTCCGTCGCCTGTTCGGCGATGAG
TTCGCGCGTGCCTACGAGGCGCAACTGGCGCGCTTGAAATCGGCACGGCGGCATTGA