SecReT6
Protein ID: 470473930
SecReT6 ID740
T6SS typei3
Gene symbol-
Locus tagXAC29_20770
StrainXanthomonas axonopodis Xac29-1
Repliconchromosome [GenBank: NC_020800] [Browse all T6SS(s) in this replicon]
Location [Strand]4823075..4825042 [-]
Producthypothetical protein
NoteTssI
UniProt IDM4TZT5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.70E-70, Aligned region: 24..329
Phage_base_V [PF04717], Evalue: 2.00E-24, Aligned region: 50..64
Phage_base_V [PF04717], Evalue: 2.00E-24, Aligned region: 367..459
Protein Sequence: 655 a.a.     [Download]
>gi|470473930|ref|YP_007638498.1| hypothetical protein XAC29_20770 [Xanthomonas axonopodis Xac29-1]
MPRTIMLHSDLGERLLLHRMQASEALGQLFDYRIDALCTELQPNLRDLLGTPVAVQLADGEGEQRWYHGM
VASCAHNGYAVVDALEYAVLELQVVPKPWLLTQRRDCRIYQDMSVPEIVTSVLGEIGYGDVQQQLSAQYA
KRTYCVQYREDDFSFISRLLEREGIYYYFTHSRSAHTLVLADALGAHAAQNGVDSLPYAPPGTDDRRLMR
SVVSHWRSARGVHSSQHGSTDYDPLQPRASLAAEADASGEQLHTVDGLIAFDYPGAHTVQTDGNRYMQVR
SEAHNVQRASHAATTNACGLMVGALFRLRGFPRAELNQEYLVLSAHTTLAAPEHASGEPPFSSSVQVMES
RLPFRSLQRTVTPTIAGLQTAVVTGDTDEDIAVDAHGRVQVTFHWATAARPHAALSCWVRVASMWAGKGW
GAMSLPRVGQEVVVSFLEGDPDRPLIVGSVYNGDHAPPFSLPDNKTQSGVRSRSLLGGTADFNELRFEDK
AGAEELYLRAQRDLREEVQHDHTSTIDNDRVLTVKHDRSARIDNNDSVDVGKKLLLKAGEEIELVTGSAR
LVMKQNGEIVLSGIKILVDASSEAKITSTAIKLLADAQLQAKSPATEVAGDATLKLTSGGMLSAEAGASA
TLKGPLVSIKADALVQVGGGLIMIG
 
Nucleotide Sequence: 1968 bp     [Download]
>gi|470469929|ref|NC_020800.1|:c4825042-4823075 Xanthomonas axonopodis Xac29-1, complete genome
ATGCCGCGCACCATCATGCTGCACTCCGACCTTGGCGAGCGCCTGCTGCTGCACCGCATGCAGGCCAGCG
AAGCGTTGGGGCAGCTGTTCGACTACCGCATCGATGCGTTGTGCACCGAGCTGCAGCCCAACCTGCGTGA
TCTGCTTGGCACGCCAGTGGCGGTGCAACTGGCCGATGGCGAGGGCGAACAGCGCTGGTATCACGGCATG
GTGGCCAGTTGCGCGCACAACGGCTACGCCGTGGTCGATGCGCTCGAGTACGCCGTGCTGGAACTGCAGG
TGGTGCCCAAACCATGGCTGCTGACACAGCGCCGCGATTGCCGTATCTATCAGGACATGAGCGTGCCGGA
GATCGTCACCAGCGTGCTGGGCGAGATCGGCTACGGCGATGTGCAGCAGCAGTTGAGCGCGCAGTACGCC
AAGCGCACCTACTGCGTGCAATACCGCGAGGACGATTTCAGCTTCATCAGCCGGCTGCTGGAACGCGAAG
GCATCTACTACTACTTCACCCATAGCCGCAGTGCGCATACCTTGGTGCTGGCCGATGCGCTGGGTGCGCA
TGCAGCGCAAAATGGCGTGGACAGCTTGCCGTATGCGCCGCCGGGCACCGACGACCGGCGCCTGATGCGC
TCGGTGGTGAGCCATTGGCGCAGTGCGCGCGGCGTACATTCCAGCCAGCATGGCAGCACCGACTACGACC
CGCTGCAGCCGCGTGCATCGCTGGCCGCCGAGGCCGACGCCAGCGGCGAACAGTTGCACACCGTCGATGG
TCTGATCGCCTTCGACTATCCCGGTGCGCATACAGTGCAAACCGACGGTAATCGCTACATGCAGGTGCGC
AGCGAGGCGCACAACGTGCAGCGCGCCAGCCATGCAGCCACCACCAATGCCTGCGGCCTGATGGTCGGTG
CCTTGTTTCGCTTGCGCGGGTTTCCGCGTGCCGAACTCAATCAGGAATATCTGGTGCTGTCGGCGCACAC
CACGCTGGCCGCGCCCGAACACGCTAGCGGCGAGCCGCCGTTTTCCAGCAGCGTGCAGGTGATGGAAAGC
CGGCTGCCGTTCCGTAGCCTGCAACGCACCGTAACGCCGACCATTGCCGGCCTGCAGACGGCGGTGGTGA
CCGGCGACACCGACGAGGACATTGCGGTGGATGCGCATGGCCGCGTGCAGGTGACCTTTCACTGGGCCAC
TGCGGCACGCCCGCATGCCGCACTGTCGTGCTGGGTGCGTGTGGCCTCGATGTGGGCGGGCAAGGGCTGG
GGCGCGATGAGCCTGCCACGCGTGGGGCAGGAAGTGGTGGTGAGCTTTCTGGAAGGCGACCCGGACCGCC
CGCTGATCGTGGGCAGCGTCTACAACGGCGACCATGCGCCGCCGTTTTCCTTGCCCGACAACAAGACCCA
AAGCGGCGTGCGCAGCCGCAGCCTGCTGGGCGGCACTGCCGATTTCAACGAGCTGCGATTCGAAGACAAG
GCCGGCGCAGAAGAGCTCTACCTGCGTGCGCAACGCGATCTGCGCGAAGAAGTGCAGCACGATCACACCA
GCACCATCGACAACGATCGGGTGCTGACCGTCAAGCACGACCGCAGCGCGCGTATCGACAATAACGACAG
CGTGGATGTCGGCAAGAAGCTGCTGCTGAAAGCCGGCGAAGAGATCGAGTTGGTGACCGGCAGCGCGCGC
CTGGTGATGAAGCAGAACGGCGAGATCGTGTTGAGCGGCATCAAGATCCTGGTCGATGCCAGCTCGGAAG
CCAAGATCACCTCCACCGCCATCAAGCTCCTTGCCGATGCACAGCTGCAGGCCAAATCGCCGGCCACCGA
AGTGGCTGGCGATGCCACGCTTAAACTGACCTCCGGCGGCATGCTCAGTGCCGAAGCCGGTGCCTCGGCC
ACGCTCAAGGGTCCTTTGGTCAGCATCAAGGCCGACGCCTTGGTGCAGGTCGGCGGCGGCCTGATCATGA
TCGGATGA