SecReT6
Protein ID: 470473944
SecReT6 ID740
T6SS typei3
Gene symbol-
Locus tagXAC29_20840
StrainXanthomonas axonopodis Xac29-1
Repliconchromosome [GenBank: NC_020800] [Browse all T6SS(s) in this replicon]
Location [Strand]4847233..4848273 [-]
Producthypothetical protein
NoteTssG
UniProt IDM4TZJ3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.80E-105, Aligned region: 25..329
Protein Sequence: 346 a.a.     [Download]
>gi|470473944|ref|YP_007638512.1| hypothetical protein XAC29_20840 [Xanthomonas axonopodis Xac29-1]
MASPARHAPAPVSAAAAALAQALQTRPQDFSPFAALRAIERCHPQQPRLGESARASDDVLRLRHAPSLAF
APHALHRYTPATHDQPAALYGVFFGLFGPNAPLPLHLTEYAIERAQQAKDGTFAAFADVFHHRMLSLFYR
AWAQAQPSVQAERPASDQFRAWLDALVGIASPHLRQRDALPDDARRYYAGRLGTATRTPEGLRALLQQLF
EWPVQVQEFIAEWMRLPADAHLQLGLGPRNARLGVDSVVGAHVRGAQQRVRIRLGPLPRLAFQRFLPGGQ
ALKQLTATVRSYLGDEFGWELQLSLKADEVPTPHLARNSRLGLDTWLGRRAWSIADADDVVLHPSG
 
Nucleotide Sequence: 1041 bp     [Download]
>gi|470469929|ref|NC_020800.1|:c4848273-4847233 Xanthomonas axonopodis Xac29-1, complete genome
GTGGCCAGCCCAGCCCGGCACGCGCCCGCGCCTGTGAGCGCCGCGGCTGCCGCGCTGGCACAGGCGCTGC
AGACCCGGCCACAGGATTTCAGCCCATTCGCGGCCTTGCGCGCGATCGAACGCTGCCATCCGCAGCAGCC
GCGCCTGGGCGAATCGGCGCGCGCCAGCGACGATGTGCTGCGGCTGCGGCATGCGCCGTCACTGGCATTC
GCACCCCATGCGCTGCACCGCTACACACCGGCAACGCACGATCAGCCTGCCGCGCTGTATGGCGTGTTTT
TCGGTCTTTTCGGGCCAAACGCGCCGTTGCCGTTGCACCTGACCGAATACGCCATCGAGCGTGCGCAGCA
AGCCAAGGACGGCACCTTCGCCGCGTTTGCCGATGTGTTCCACCACCGCATGCTGAGCCTGTTCTACCGC
GCCTGGGCGCAGGCACAGCCCAGCGTGCAGGCCGAGCGCCCGGCGAGCGACCAGTTCCGTGCGTGGCTGG
ATGCATTGGTGGGCATCGCCAGCCCGCACCTGCGCCAACGCGATGCATTGCCGGACGATGCACGTCGTTA
CTACGCCGGCCGTCTTGGCACCGCCACACGCACGCCGGAAGGCTTGCGTGCCCTGCTGCAACAGTTGTTC
GAATGGCCGGTGCAGGTACAGGAATTCATCGCCGAATGGATGCGCCTGCCGGCCGATGCGCACCTGCAAC
TTGGTTTGGGTCCGCGCAACGCGCGGCTGGGCGTGGACAGCGTGGTGGGCGCACACGTGCGTGGCGCCCA
GCAACGCGTGCGCATCCGCCTGGGGCCGCTGCCGCGCCTGGCGTTTCAACGCTTTCTGCCGGGTGGCCAG
GCGCTGAAGCAACTCACCGCCACGGTGCGCAGCTATCTGGGCGACGAATTCGGCTGGGAACTGCAGCTGT
CGCTCAAGGCCGACGAGGTCCCTACGCCGCACCTGGCGCGCAATAGCCGGCTGGGCCTGGACACCTGGCT
GGGCCGCCGCGCCTGGAGCATTGCCGATGCCGACGACGTGGTGCTGCACCCCTCCGGGTGA