SecReT6
Protein ID: 470473945
SecReT6 ID740
T6SS typei3
Gene symbol-
Locus tagXAC29_20845
StrainXanthomonas axonopodis Xac29-1
Repliconchromosome [GenBank: NC_020800] [Browse all T6SS(s) in this replicon]
Location [Strand]4848237..4850120 [-]
Producthypothetical protein
NoteTssF
UniProt IDM4TZU9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.10E-221, Aligned region: 5..625
Protein Sequence: 627 a.a.     [Download]
>gi|470473945|ref|YP_007638513.1| hypothetical protein XAC29_20845 [Xanthomonas axonopodis Xac29-1]
MDPRLLPYYTRELQHVRDMGAEFAREYPKIAGRLGLDAFECADPYVERLLEGFAFLAARVQLKLDAQYPV
FTQHLLEMVYPHYLAPLPSMAVVQLQPDLKDSGLAAGVVVSRQSALRSLVGPGERTACEFRTAHPVTLWP
LQLAEAKYLESPAALAAAGIALPPGRVVRAGVRLRFELVGGAQTHALALDRLPLFLAGADGLPKRLYEQL
HADTTAVVVRGSDARGGTLEVTLDADAVQMRGFADDDALIPYDGRSFSGYRLLQEYFACPERFLFAELAG
LRAPLRRLHGSSFEVVVLLQRSLPSLAAAVDAEHFKLFCTPAINLFPRRADRIHLQAGLHEYHVLADRTR
PMDFEIHHLGEVEGFGDRQEPEQCFTAFYGGDARTWHARHGAFYSMRREPRMLSARQRRDGARSSYVGSE
VFVSLVDADDQAHSTRLRQLGLQLWCSNRDLPLHMPVGKGASDFTMDSGVPVRSVRCVAGPTKPRPALSD
GQTAWRLLSQLQLNYLSLFEDGPDGAAALREILALYCDPFDASAQRQIEGVKQVSGTPIVRRIPVPGPIT
FGRGLEITLTCEDAAFEGTGAFLLASVLRHFFARYVSVNSFTETVLRTTERNEVARWPAQPGTRPRL
 
Nucleotide Sequence: 1884 bp     [Download]
>gi|470469929|ref|NC_020800.1|:c4850120-4848237 Xanthomonas axonopodis Xac29-1, complete genome
ATGGACCCGCGCCTACTGCCGTACTACACCCGCGAGTTGCAGCACGTGCGCGACATGGGCGCGGAGTTTG
CGCGCGAGTATCCCAAGATCGCCGGCCGGCTTGGCCTGGACGCGTTCGAATGCGCCGACCCCTATGTCGA
GCGGCTGCTGGAAGGCTTCGCGTTTCTGGCCGCGCGCGTGCAACTCAAGCTGGACGCGCAGTACCCGGTG
TTCACCCAGCACCTGCTGGAGATGGTCTACCCGCATTATCTGGCGCCGCTGCCGTCGATGGCGGTGGTGC
AGTTGCAGCCGGATCTGAAAGACAGCGGGCTGGCAGCAGGCGTCGTCGTGTCGCGGCAAAGCGCGCTGCG
CAGCCTGGTCGGCCCCGGCGAGCGCACCGCCTGCGAATTCCGCACCGCGCATCCGGTGACCTTGTGGCCG
TTGCAACTGGCCGAGGCCAAGTATCTGGAATCGCCAGCCGCCTTGGCCGCTGCCGGCATCGCTTTGCCGC
CCGGGCGCGTGGTGCGTGCCGGCGTGCGGCTGCGCTTCGAGCTGGTGGGTGGTGCGCAGACGCACGCGCT
GGCGCTGGATCGGCTGCCGCTGTTTCTGGCCGGCGCCGACGGCCTGCCCAAGCGGTTGTACGAACAACTG
CATGCCGATACCACCGCCGTGGTGGTGCGTGGCAGCGATGCCCGCGGTGGCACGCTGGAGGTGACGCTGG
ACGCCGATGCCGTGCAGATGCGCGGCTTTGCCGACGACGATGCATTGATTCCGTACGACGGCCGTTCGTT
CAGTGGCTATCGCCTGCTGCAGGAGTATTTCGCCTGCCCGGAGCGCTTTTTGTTCGCAGAGCTCGCCGGG
CTGCGCGCGCCATTGCGGCGGTTGCACGGCAGCAGCTTCGAGGTGGTGGTGTTGCTGCAACGCAGCCTGC
CCAGCCTGGCTGCGGCAGTAGACGCCGAGCACTTCAAATTGTTCTGCACCCCGGCGATCAATCTGTTCCC
GCGCCGCGCCGATCGCATCCATCTGCAGGCCGGGTTGCACGAGTACCACGTGCTGGCCGACCGCACCCGG
CCGATGGATTTCGAGATCCATCACCTGGGCGAGGTCGAAGGCTTCGGCGATCGTCAGGAGCCCGAGCAAT
GCTTCACCGCGTTCTATGGTGGCGACGCACGCACCTGGCATGCACGGCATGGCGCGTTCTACAGCATGCG
CCGTGAACCGCGCATGCTATCGGCACGTCAGCGCCGCGATGGCGCGCGGTCGAGCTATGTGGGCAGCGAA
GTCTTCGTCAGCCTGGTCGATGCCGACGATCAGGCCCACAGCACGCGCCTGCGTCAGCTTGGGCTGCAAC
TGTGGTGCAGCAACCGCGATCTGCCGCTGCATATGCCGGTAGGCAAGGGCGCAAGCGACTTCACCATGGA
CAGCGGCGTGCCGGTACGGAGCGTGCGCTGCGTGGCCGGGCCGACCAAGCCGCGCCCGGCATTGTCGGAT
GGGCAGACTGCGTGGCGCCTGCTCAGTCAATTGCAGCTCAATTATCTGTCGCTGTTCGAAGATGGCCCCG
ACGGCGCCGCTGCGCTACGCGAGATCCTCGCCCTGTATTGCGACCCGTTCGACGCGTCCGCGCAGCGGCA
GATCGAAGGCGTCAAGCAGGTGAGCGGCACACCGATCGTGCGGCGCATTCCGGTGCCGGGTCCGATCACC
TTCGGCCGCGGCCTGGAGATCACGCTGACCTGCGAGGACGCCGCCTTCGAAGGCACTGGCGCCTTCCTGC
TGGCTTCGGTGCTGCGGCACTTCTTCGCGCGCTATGTCTCGGTGAATTCCTTTACCGAAACCGTGCTGCG
TACCACCGAACGCAACGAGGTGGCCCGGTGGCCAGCCCAGCCCGGCACGCGCCCGCGCCTGTGA