SecReT6
Protein ID: 470473947
SecReT6 ID740
T6SS typei3
Gene symbol-
Locus tagXAC29_20855
StrainXanthomonas axonopodis Xac29-1
Repliconchromosome [GenBank: NC_020800] [Browse all T6SS(s) in this replicon]
Location [Strand]4850634..4851428 [-]
Producthypothetical protein
NoteTagJ
UniProt IDM4U1S2
KEGG IDxao:XAC29_20855
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 3.90E-42, Aligned region: 139..261
TPR_16 [PF13432], Evalue: 1.90E-05, Aligned region: 5..59
TPR_16 [PF13432], Evalue: 1.90E-05, Aligned region: 107..149
Protein Sequence: 264 a.a.     [Download]
>gi|470473947|ref|YP_007638515.1| hypothetical protein XAC29_20855 [Xanthomonas axonopodis Xac29-1]
MDATAQTLLAQGEPAQALQQLIQQVRRQPADAAQRVFLFQLLAVLGQWSRAADQLRACGELDATTQPLVH
TYLAVLQGEQTRAEVFAGKRLPRVMGEPAEWLAMHLQALQLAAQGHGEQAAALRAQAFERAPASAGVLNG
ERFQWLADADTRFGPCIELILDSGYAWAPLSQIQQLRMQAPLDLRDTVWAPVSVLWRNGGQAFGYLPVRY
PGSEHLDAGELQLARRTEWTLVAQGEIGMGQRMWSTESREIALLDVRDVQFDAG
 
Nucleotide Sequence: 795 bp     [Download]
>gi|470469929|ref|NC_020800.1|:c4851428-4850634 Xanthomonas axonopodis Xac29-1, complete genome
ATGGATGCCACCGCACAGACCCTGCTTGCCCAAGGCGAGCCGGCGCAGGCGTTGCAGCAACTGATCCAGC
AGGTGCGCCGGCAACCGGCCGATGCAGCGCAGCGCGTGTTTCTGTTTCAGTTGCTGGCCGTCCTCGGCCA
GTGGTCGCGCGCCGCAGATCAGCTGCGTGCTTGCGGTGAACTGGATGCCACCACGCAGCCCTTGGTCCAC
ACCTATCTGGCGGTATTGCAGGGCGAGCAGACGCGCGCCGAGGTGTTTGCCGGTAAGCGGTTACCGCGCG
TGATGGGTGAGCCGGCCGAGTGGCTGGCAATGCATCTGCAGGCGCTGCAACTGGCGGCGCAAGGGCATGG
CGAACAAGCAGCGGCGTTGCGGGCGCAGGCCTTCGAACGGGCACCAGCCAGTGCCGGCGTGCTCAATGGC
GAACGCTTCCAATGGCTCGCAGATGCCGACACCCGTTTCGGGCCCTGTATCGAGCTCATTCTCGATAGCG
GCTATGCATGGGCCCCGCTCAGCCAGATCCAGCAGCTGCGCATGCAGGCGCCGCTGGATCTGCGCGACAC
CGTGTGGGCGCCGGTGAGCGTGCTGTGGCGCAACGGCGGCCAGGCCTTCGGCTACTTGCCGGTACGTTAC
CCCGGCAGCGAGCACCTGGATGCCGGCGAGCTGCAACTGGCGCGCCGCACCGAATGGACCCTTGTCGCAC
AAGGCGAGATCGGCATGGGCCAGCGCATGTGGAGCACCGAGTCGCGCGAGATTGCGCTGCTGGATGTGCG
CGATGTGCAGTTCGACGCGGGCTGA