SecReT6
Protein ID: 470473949
SecReT6 ID740
T6SS typei3
Gene symbol-
Locus tagXAC29_20865
StrainXanthomonas axonopodis Xac29-1
Repliconchromosome [GenBank: NC_020800] [Browse all T6SS(s) in this replicon]
Location [Strand]4852211..4853704 [-]
Producthypothetical protein
NoteTssC
UniProt IDM4TZJ7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.40E-193, Aligned region: 66..492
BMFP [PF04380], Evalue: 0.00069, Aligned region: 20..58
BMFP [PF04380], Evalue: 0.00069, Aligned region: 60..90
Protein Sequence: 497 a.a.     [Download]
>gi|470473949|ref|YP_007638517.1| hypothetical protein XAC29_20865 [Xanthomonas axonopodis Xac29-1]
MSATEAALATRSIETTERGDFAALLNREFRPKSERAKEEVESAVRTLAEQVLNRSDVVGEDVSQTIKAYI
AEIDRTLTEQLNQILHHADLQQLEGAWRGLHYLVNNTETDQQLKIRVLNISKKELGKVLKRYKGTAWDQS
PIFKKVYEQEYGQLGGEPYGCLVGDYYFDQSPPDVELLNGIAQVAAAAHAPFIAAAAPKLMGMDNWSELS
NPRDLAKIFSTPDYAAWRSLRESEDSKYIGLAMPRTLSRLPYGAATSPVEDFDFEEDTAGADSNKYTWQN
AAYAMAVNINRSFKQYGWCSRIRGIESGGAVEGLPTHTFPTDDGGVDMKCPTEVAITDRRSAELDKMGLM
PLVHRKNSDMAAFISAQSLNKPDEYDDPDATANAALGARLPYMFACCRFAHYLKCIVRDKIGSFSDREQM
QSWLTRWVTQYIDGDPSNSSEETKARKPLAAAEVVVEEVEGAPGYYSSKFFLKPHYQLEGLTVSLRLVSR
LPSAAKA
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|470469929|ref|NC_020800.1|:c4853704-4852211 Xanthomonas axonopodis Xac29-1, complete genome
ATGTCCGCGACCGAAGCCGCACTGGCCACCCGTAGCATCGAAACAACCGAGCGGGGCGACTTTGCCGCGC
TGCTCAATCGCGAGTTCCGTCCCAAGAGCGAGCGCGCCAAGGAAGAAGTGGAATCGGCGGTGCGCACGCT
CGCCGAGCAGGTGCTCAACCGCAGCGATGTGGTTGGCGAAGACGTATCGCAGACCATCAAGGCCTACATC
GCCGAGATCGACCGCACGCTCACCGAACAGCTCAACCAGATCCTGCATCACGCCGATCTGCAACAGCTCG
AAGGCGCCTGGCGCGGCCTGCATTATCTGGTCAACAACACCGAGACCGACCAGCAGCTCAAGATCCGCGT
GCTGAATATCAGCAAGAAAGAGTTGGGCAAGGTACTCAAACGCTACAAGGGTACCGCGTGGGATCAGAGC
CCCATCTTCAAGAAAGTCTACGAACAGGAATATGGCCAGCTTGGCGGCGAGCCGTATGGGTGCCTGGTCG
GCGATTATTACTTCGACCAGAGTCCGCCGGATGTGGAACTGCTCAACGGTATTGCGCAGGTGGCCGCTGC
CGCGCACGCACCGTTCATTGCCGCCGCCGCGCCCAAATTGATGGGCATGGACAACTGGAGCGAGCTCTCC
AATCCGCGCGATCTGGCCAAGATTTTTTCCACGCCCGATTACGCTGCATGGCGCTCGCTGCGCGAATCCG
AAGACTCCAAGTACATCGGTCTGGCCATGCCGCGCACGCTCTCGCGTCTACCTTACGGCGCGGCCACCAG
CCCGGTGGAAGACTTCGATTTCGAGGAAGACACCGCCGGCGCGGATTCCAACAAGTACACCTGGCAGAAT
GCCGCCTATGCGATGGCGGTGAACATCAACCGCTCGTTCAAGCAGTACGGCTGGTGCTCGCGCATTCGCG
GTATCGAGTCCGGCGGCGCAGTGGAAGGGTTGCCCACGCATACCTTTCCCACCGACGACGGTGGCGTGGA
CATGAAGTGCCCGACCGAAGTGGCGATCACCGACCGTCGCTCCGCCGAACTGGACAAGATGGGCCTCATG
CCGCTGGTACATCGCAAGAACTCGGACATGGCCGCCTTCATCAGCGCGCAGTCGCTCAACAAGCCCGACG
AATACGACGACCCGGATGCCACCGCCAACGCAGCATTAGGCGCGCGCCTGCCCTACATGTTTGCGTGCTG
CCGCTTTGCGCACTACCTCAAGTGCATCGTGCGCGACAAGATCGGTTCGTTCTCCGATCGCGAGCAGATG
CAGAGCTGGCTGACACGCTGGGTGACGCAATACATCGACGGCGACCCGTCCAACTCCAGCGAAGAAACCA
AGGCGCGCAAGCCGCTGGCTGCCGCCGAAGTGGTGGTGGAAGAAGTGGAAGGCGCGCCTGGCTACTACAG
CTCCAAGTTCTTCCTCAAGCCGCATTACCAGCTGGAGGGCCTGACCGTGTCGTTGCGGTTGGTCTCGCGG
TTGCCCTCGGCCGCCAAGGCCTGA