SecReT6
Protein ID: 470473950
SecReT6 ID740
T6SS typei3
Gene symbol-
Locus tagXAC29_20870
StrainXanthomonas axonopodis Xac29-1
Repliconchromosome [GenBank: NC_020800] [Browse all T6SS(s) in this replicon]
Location [Strand]4853708..4854217 [-]
Producthypothetical protein
NoteTssB
UniProt IDM4TZV2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.00E-59, Aligned region: 8..159
Protein Sequence: 169 a.a.     [Download]
>gi|470473950|ref|YP_007638518.1| hypothetical protein XAC29_20870 [Xanthomonas axonopodis Xac29-1]
MASSQKFIARNRAPRVQIEYDVEVYGAQKKVQIPFVMGVMSDLSGANAGELPSLDERKALEIDVDNFDSR
LQSMGPRAQFKVPNTLTGEGELAVDITFESMDDFSPAAIARKVAPLAKLLEARTQLANLDTYMDGKAGAE
QLIANAIRDPALLQSLVSAGKPASEPEGT
 
Nucleotide Sequence: 510 bp     [Download]
>gi|470469929|ref|NC_020800.1|:c4854217-4853708 Xanthomonas axonopodis Xac29-1, complete genome
ATGGCCAGCAGTCAGAAGTTCATCGCCCGCAATCGGGCGCCACGGGTGCAGATCGAATACGACGTGGAGG
TCTACGGCGCGCAGAAGAAGGTGCAGATTCCGTTCGTGATGGGGGTGATGTCGGATCTGTCCGGCGCCAA
CGCCGGTGAGCTGCCCTCGCTGGATGAGCGCAAGGCACTGGAGATCGACGTCGACAACTTCGACAGCCGT
CTGCAGTCGATGGGCCCGCGCGCGCAATTCAAGGTGCCCAACACGCTCACCGGCGAAGGCGAGCTGGCGG
TGGATATCACCTTCGAAAGCATGGACGACTTTTCGCCGGCCGCCATCGCGCGCAAGGTTGCGCCGTTGGC
CAAATTGCTGGAAGCGCGCACGCAGTTGGCCAACCTGGACACCTACATGGACGGCAAGGCCGGTGCAGAG
CAGCTGATCGCCAACGCTATCCGCGATCCGGCGTTGCTGCAGTCGCTGGTGTCGGCCGGCAAGCCCGCGT
CCGAACCGGAAGGAACCTGA