SecReT6
Protein ID: 470479710
SecReT6 ID741
T6SS typei1
Gene symbol-
Locus tagPCNPT3_08390
StrainPsychromonas sp. CNPT3
Repliconchromosome [GenBank: NC_020802] [Browse all T6SS(s) in this replicon]
Location [Strand]1980933..1982972 [-]
ProductvgrG protein
NoteTssI
UniProt IDM4U7L6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 9.10E-68, Aligned region: 25..325
Phage_GPD [PF05954], Evalue: 9.10E-68, Aligned region: 563..571
Phage_base_V [PF04717], Evalue: 4.70E-23, Aligned region: 364..456
Phage_Mu_Gp45 [PF06890], Evalue: 0.00093, Aligned region: 416..443
Phage_Mu_Gp45 [PF06890], Evalue: 0.00093, Aligned region: 618..665
Protein Sequence: 679 a.a.     [Download]
>gi|470479710|ref|YP_007640454.1| vgrG protein [Psychromonas sp. CNPT3]
MATGLQFTLSVGDIDNLSVLKFTGEEALSSTYQYDLQLASRDARISAEQVVDQVVLLSIFQDGIVQQRIH
GIACSFERGDTGHHHTYYSLTLVPALHRLSLRHNSRIFQQKSVPEIISCLLVEMGIDDFAFSLSGTSQKR
EYCVQYRETDLDFIQRLGAEEGIFYHFTHSVDKHTLIFSNDSQVLSTLKEPVLYNALSSGVSKRPFVRSF
SQKMQMQPSYASLKDHSFKKPAYSFLHQQQGIEMAYQRPSYEHYDHPGRYKDDINGKAFTRVRIEQLRRD
SNVATAESNVPQLLSGLKFELQDHPETAINRDWLLVSLTHVGTQPQALEESGGEGMTTYNNTFVAIPGHR
QWRSVSEHKPRVDGPQIAMVVGPAGEEIFCDEFGRVKIHFPWDRYNNTDENASCWVRVSQGWAGGQYGMM
ALPRIGHEVIVSFLEGDPDQPIITGRSYHAANLPPYGLPGNKTKTVLRTQTHKGTGFNELSFEDENDQEL
IYLHAEKDHHEDINHDQKLTVGNDRNKHIGRDQRLKVEQDESNEIGRDQRHKIGQDQHVEIGQDKKTVVG
RHYRLEVKDRRHEFSRANHDLEVDGHYTQKVQGKTIFESAESVLIHTKELTLNGSKKIVIQGPSGKITID
SSGVTIDAPIIKLNGKVIVATGSVSPITSLKSATNTGNAFVDECKDCGE
 
Nucleotide Sequence: 2040 bp     [Download]
>gi|470478036|ref|NC_020802.1|:c1982972-1980933 Psychromonas sp. CNPT3, complete genome
ATGGCAACAGGACTACAGTTCACGTTAAGTGTTGGCGATATTGATAACTTAAGTGTACTTAAATTTACAG
GTGAAGAAGCGCTCTCATCAACCTATCAATATGACCTTCAGCTTGCCAGTCGTGATGCGCGTATTAGCGC
TGAGCAGGTAGTTGATCAAGTGGTGCTGTTAAGCATATTTCAAGATGGTATCGTGCAACAGCGTATTCAT
GGCATTGCTTGCTCATTTGAGCGAGGCGATACAGGGCATCATCATACATATTACAGCCTTACGTTAGTAC
CTGCCTTACACCGCTTATCTTTACGTCATAATAGCCGGATTTTTCAACAAAAATCGGTGCCTGAGATTAT
CTCTTGTTTATTGGTTGAAATGGGCATTGATGATTTTGCATTTTCACTCTCAGGTACGTCTCAAAAACGC
GAATATTGTGTGCAGTACAGAGAAACAGATCTCGATTTTATCCAGCGTTTAGGCGCTGAAGAGGGCATTT
TTTATCACTTTACGCATAGCGTAGACAAGCACACGTTGATATTTAGTAATGACAGCCAAGTGCTCAGCAC
CTTAAAAGAGCCTGTGCTTTACAACGCATTAAGTAGTGGCGTTAGTAAGCGTCCTTTTGTGCGCTCTTTT
TCTCAAAAAATGCAGATGCAACCTAGCTATGCGAGCCTTAAAGATCACAGTTTTAAAAAGCCTGCCTACA
GTTTTTTACATCAGCAACAAGGGATTGAGATGGCGTATCAGCGCCCAAGTTATGAACATTATGATCACCC
CGGTCGCTATAAAGATGACATTAATGGTAAAGCATTTACGCGTGTTCGTATCGAGCAATTACGCCGTGAT
TCAAATGTGGCCACGGCTGAAAGTAACGTGCCTCAATTACTCTCAGGTTTGAAGTTTGAATTACAAGATC
ATCCCGAGACCGCCATCAATCGTGATTGGTTATTGGTGTCGCTCACTCATGTGGGCACGCAGCCACAAGC
GCTTGAAGAGTCAGGTGGCGAGGGCATGACCACTTACAATAATACCTTTGTGGCTATCCCCGGACATCGC
CAATGGCGCAGCGTAAGTGAACATAAACCTCGCGTTGATGGGCCGCAAATTGCCATGGTGGTAGGGCCGG
CAGGAGAAGAGATTTTTTGTGATGAATTTGGACGGGTTAAAATTCACTTTCCATGGGATCGCTATAACAA
CACCGACGAAAATGCCAGTTGCTGGGTACGCGTAAGCCAAGGTTGGGCGGGTGGCCAGTACGGCATGATG
GCACTGCCACGCATTGGTCATGAAGTGATTGTGAGCTTTTTAGAGGGCGATCCCGACCAACCCATTATTA
CGGGGCGCAGTTACCATGCTGCTAACTTGCCACCTTATGGCTTGCCGGGAAACAAAACCAAAACAGTGTT
ACGTACCCAAACACATAAAGGCACGGGCTTTAATGAATTGAGCTTTGAAGATGAAAATGATCAGGAATTA
ATTTATCTCCATGCGGAAAAAGACCATCACGAAGATATTAACCACGATCAAAAATTAACCGTCGGCAATG
ACCGAAATAAACACATTGGTCGAGATCAACGTTTAAAAGTAGAGCAAGACGAGTCGAACGAAATTGGTCG
CGACCAACGTCATAAAATTGGTCAAGACCAACACGTTGAAATTGGTCAAGATAAAAAAACAGTGGTGGGA
CGCCATTATCGACTCGAAGTAAAAGATCGCCGTCATGAATTTTCACGCGCCAATCATGATCTGGAAGTCG
ACGGTCACTATACGCAAAAAGTACAAGGTAAAACGATATTCGAATCCGCTGAAAGCGTTCTTATTCACAC
CAAAGAACTCACCTTAAACGGCTCTAAAAAAATAGTGATTCAAGGGCCGTCAGGAAAAATAACCATTGAT
TCTTCAGGCGTTACTATCGACGCACCAATAATCAAACTCAACGGTAAAGTGATTGTGGCCACGGGCAGTG
TGTCTCCAATAACGTCGTTAAAAAGTGCCACAAACACCGGTAATGCTTTTGTGGATGAATGCAAAGATTG
TGGGGAATAA