SecReT6
Protein ID: 470479711
SecReT6 ID741
T6SS typei1
Gene symbol-
Locus tagPCNPT3_08395
StrainPsychromonas sp. CNPT3
Repliconchromosome [GenBank: NC_020802] [Browse all T6SS(s) in this replicon]
Location [Strand]1983059..1983754 [-]
Producthypothetical protein
NoteTssA
UniProt IDM4U8X2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.50E-10, Aligned region: 46..93
Protein Sequence: 231 a.a.     [Download]
>gi|470479711|ref|YP_007640455.1| hypothetical protein PCNPT3_08395 [Psychromonas sp. CNPT3]
MSKLYFSDTSQFKLVLDEAQLRGSALYEQIRNEINRRFRPFSGGPDWEKIRILCERVGASEGVDLLVSIY
YTVAAVKTQGLLGLANGLELQVAVNNAFLASSEFPAQRRVELYTWMISRVAPEIRILKASPEQLRELYRC
ERACQRLYAMLEKHQPDHVPDIESIAFLVFEHIDQLETHRISHLIEKSNIVKTKQKNKTHCMLSFSIGII
VAVLLMISFTHIGVNVLLITE
 
Nucleotide Sequence: 696 bp     [Download]
>gi|470478036|ref|NC_020802.1|:c1983754-1983059 Psychromonas sp. CNPT3, complete genome
GTGAGTAAGTTGTATTTTTCTGATACAAGCCAATTTAAATTGGTATTAGATGAAGCTCAGTTACGTGGAT
CCGCGTTATATGAACAAATCCGTAATGAGATAAATCGTCGTTTTAGGCCTTTTTCTGGAGGGCCTGATTG
GGAAAAAATACGTATTTTGTGTGAGCGTGTTGGGGCAAGTGAAGGCGTTGATCTACTGGTTTCTATTTAT
TATACCGTAGCAGCGGTTAAAACGCAGGGTTTACTAGGCTTAGCAAATGGTTTAGAGCTACAAGTTGCGG
TCAATAATGCGTTTTTAGCCTCGTCAGAGTTTCCTGCGCAACGACGCGTTGAATTATATACGTGGATGAT
TTCGCGAGTGGCACCGGAGATCCGCATCTTAAAGGCGAGTCCAGAACAATTGCGAGAGCTTTATCGTTGT
GAGCGTGCATGTCAACGTTTATATGCCATGTTAGAGAAACATCAACCCGATCATGTACCCGATATAGAGT
CAATTGCTTTTCTTGTTTTTGAGCATATTGATCAATTAGAAACACATCGCATTAGTCATCTGATAGAGAA
GAGCAATATTGTTAAAACAAAGCAAAAAAATAAAACGCATTGTATGCTCAGTTTTTCTATCGGCATCATC
GTCGCGGTGTTGTTGATGATAAGTTTTACGCATATAGGTGTGAATGTTTTATTAATAACTGAATAG