SecReT6
Protein ID: 470479713
SecReT6 ID741
T6SS typei1
Gene symbol-
Locus tagPCNPT3_08405
StrainPsychromonas sp. CNPT3
Repliconchromosome [GenBank: NC_020802] [Browse all T6SS(s) in this replicon]
Location [Strand]1987529..1988950 [-]
Producthypothetical protein
NoteTssA
UniProt IDM4U5T2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.10E-17, Aligned region: 49..109
TPR_15 [PF13429], Evalue: 0.0074, Aligned region: 383..426
Protein Sequence: 473 a.a.     [Download]
>gi|470479713|ref|YP_007640457.1| hypothetical protein PCNPT3_08405 [Psychromonas sp. CNPT3]
MNMKNYRERIKKPIRAKCAVGERLLDDPLLDFVETQMIKVGSLSHGEVQWDEIEKICMNLLENKTKDLKI
LTYLLQCMQYQASAERFTLSVYILIDFMTAFWETCYPAPGDRGALPRRKFFSQIAQRTFKSAQNLDAEMF
AVDLKVELENAIEQWKEVVKTYSLPLTLVDDVQVLLTNKLSPLSVDTVLPGTSESSTLKAESENTASNLS
AISKFKTDSSSDRATKQTLFKMADFLTELDNGSVYSLRLRRLATWLAVVSLPDADQHGQTQLMPLSIDRI
QEYEDQLERGADLVLWRKVEKSLTLTPFWLDGHYLSFRIAMKLGEKDLATAIRDELLIFIGRLPTLLNMS
FQGSVAFASQETQRWLNDVNNCNSLGTMPGLWDETLKKAFVLAEDGGVSVALAMLNEGLKEAKEPRDKFY
WRMLSADVMHNYKLGALASAQYTTLKIQAQSFSVTDWEPSLIQRLENVTDIKA
 
Nucleotide Sequence: 1422 bp     [Download]
>gi|470478036|ref|NC_020802.1|:c1988950-1987529 Psychromonas sp. CNPT3, complete genome
ATGAACATGAAAAATTATCGTGAACGAATAAAAAAACCTATCCGAGCGAAATGCGCGGTGGGTGAGCGTC
TGCTTGATGATCCGTTACTTGATTTTGTGGAAACACAGATGATAAAAGTGGGCTCTCTTTCACATGGTGA
AGTGCAGTGGGATGAAATAGAGAAGATCTGTATGAATTTATTGGAGAATAAAACAAAAGATCTAAAAATA
TTAACATACTTACTACAATGTATGCAGTATCAAGCAAGCGCAGAGCGTTTCACGTTATCTGTGTATATAT
TAATTGATTTTATGACTGCCTTTTGGGAGACCTGCTATCCGGCTCCTGGTGATAGAGGGGCATTACCACG
TCGTAAATTTTTTAGTCAAATAGCGCAAAGAACATTTAAATCTGCACAAAACTTAGATGCTGAAATGTTT
GCTGTTGATTTAAAAGTCGAACTTGAAAATGCCATTGAGCAATGGAAAGAGGTAGTAAAAACATATTCAT
TACCGCTTACTTTAGTTGATGACGTACAAGTTTTATTAACGAATAAATTATCACCGCTTAGTGTGGATAC
CGTATTACCTGGAACGTCAGAGTCGAGTACTTTAAAGGCTGAGAGCGAAAATACGGCCTCGAATTTATCT
GCTATTAGCAAGTTTAAAACTGACAGTAGTAGCGATCGTGCTACGAAACAAACGTTATTTAAAATGGCCG
ATTTTTTAACTGAGCTGGATAATGGCTCTGTTTACAGCTTACGTTTGCGTCGTTTAGCGACGTGGTTAGC
GGTTGTTTCGCTACCTGATGCAGATCAACATGGGCAAACACAATTAATGCCGTTATCAATAGATCGTATT
CAAGAGTATGAAGATCAATTAGAGCGAGGGGCAGATTTAGTTTTATGGCGTAAAGTAGAAAAAAGCTTGA
CGTTAACGCCATTTTGGCTCGATGGACATTATTTAAGTTTTCGAATAGCGATGAAATTAGGCGAAAAAGA
TTTAGCGACAGCTATAAGGGATGAGCTTTTAATTTTTATCGGGCGTCTACCCACTTTATTAAACATGTCT
TTTCAAGGCTCAGTTGCATTTGCGAGTCAAGAAACGCAGCGCTGGCTCAATGATGTTAATAATTGTAACT
CGTTAGGTACAATGCCGGGTTTATGGGATGAAACCTTAAAAAAAGCATTTGTATTGGCTGAAGATGGAGG
TGTTTCTGTGGCATTAGCGATGTTAAATGAAGGTTTAAAAGAGGCTAAAGAGCCACGTGATAAATTTTAT
TGGCGAATGTTATCTGCCGATGTAATGCATAACTATAAATTAGGCGCGTTAGCGAGTGCACAATATACAA
CATTAAAAATTCAAGCCCAGTCATTTTCTGTTACTGATTGGGAACCGTCACTTATTCAGCGTCTTGAAAA
CGTGACTGACATTAAAGCGTAG