SecReT6
Protein ID: 470479716
SecReT6 ID741
T6SS typei1
Gene symbol-
Locus tagPCNPT3_08420
StrainPsychromonas sp. CNPT3
Repliconchromosome [GenBank: NC_020802] [Browse all T6SS(s) in this replicon]
Location [Strand]1991281..1993992 [-]
ProductClpV protein
NoteTssH
UniProt IDM4U8X5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.40E-37, Aligned region: 641..802
AAA [PF00004], Evalue: 6.00E-20, Aligned region: 221..350
AAA [PF00004], Evalue: 6.00E-20, Aligned region: 647..767
AAA_5 [PF07728], Evalue: 3.60E-14, Aligned region: 221..244
AAA_5 [PF07728], Evalue: 3.60E-14, Aligned region: 646..765
AAA_16 [PF13191], Evalue: 2.80E-13, Aligned region: 198..243
AAA_16 [PF13191], Evalue: 2.80E-13, Aligned region: 261..299
AAA_16 [PF13191], Evalue: 2.80E-13, Aligned region: 548..565
AAA_16 [PF13191], Evalue: 2.80E-13, Aligned region: 628..687
AAA_16 [PF13191], Evalue: 2.80E-13, Aligned region: 717..739
ClpB_D2-small [PF10431], Evalue: 7.70E-13, Aligned region: 808..885
Clp_N [PF02861], Evalue: 4.10E-07, Aligned region: 24..75
Clp_N [PF02861], Evalue: 4.10E-07, Aligned region: 295..317
AAA_22 [PF13401], Evalue: 5.30E-07, Aligned region: 220..311
AAA_22 [PF13401], Evalue: 5.30E-07, Aligned region: 356..387
AAA_22 [PF13401], Evalue: 5.30E-07, Aligned region: 643..672
AAA_25 [PF13481], Evalue: 3.80E-06, Aligned region: 221..243
AAA_25 [PF13481], Evalue: 3.80E-06, Aligned region: 276..317
AAA_25 [PF13481], Evalue: 3.80E-06, Aligned region: 641..679
AAA_14 [PF13173], Evalue: 1.50E-05, Aligned region: 221..332
AAA_14 [PF13173], Evalue: 1.50E-05, Aligned region: 645..735
AAA_14 [PF13173], Evalue: 1.50E-05, Aligned region: 842..881
AAA_19 [PF13245], Evalue: 8.90E-05, Aligned region: 218..245
AAA_19 [PF13245], Evalue: 8.90E-05, Aligned region: 374..397
AAA_19 [PF13245], Evalue: 8.90E-05, Aligned region: 643..668
Arch_ATPase [PF01637], Evalue: 0.00014, Aligned region: 271..369
Arch_ATPase [PF01637], Evalue: 0.00014, Aligned region: 461..498
Arch_ATPase [PF01637], Evalue: 0.00014, Aligned region: 646..684
Arch_ATPase [PF01637], Evalue: 0.00014, Aligned region: 717..728
NACHT [PF05729], Evalue: 0.00024, Aligned region: 221..248
NACHT [PF05729], Evalue: 0.00024, Aligned region: 647..674
AAA_17 [PF13207], Evalue: 0.00031, Aligned region: 221..259
AAA_17 [PF13207], Evalue: 0.00031, Aligned region: 454..487
AAA_17 [PF13207], Evalue: 0.00031, Aligned region: 647..681
DUF258 [PF03193], Evalue: 0.00069, Aligned region: 196..238
DUF258 [PF03193], Evalue: 0.00069, Aligned region: 646..687
AAA_29 [PF13555], Evalue: 0.00079, Aligned region: 214..237
AAA_29 [PF13555], Evalue: 0.00079, Aligned region: 642..657
IstB_IS21 [PF01695], Evalue: 0.0008, Aligned region: 215..280
IstB_IS21 [PF01695], Evalue: 0.0008, Aligned region: 645..658
AAA_18 [PF13238], Evalue: 0.0018, Aligned region: 221..249
AAA_18 [PF13238], Evalue: 0.0018, Aligned region: 441..469
AAA_18 [PF13238], Evalue: 0.0018, Aligned region: 647..683
MobB [PF03205], Evalue: 0.0032, Aligned region: 221..246
MobB [PF03205], Evalue: 0.0032, Aligned region: 646..668
Sigma54_activat [PF00158], Evalue: 0.0043, Aligned region: 219..237
Sigma54_activat [PF00158], Evalue: 0.0043, Aligned region: 643..745
RNA_helicase [PF00910], Evalue: 0.0067, Aligned region: 222..243
RNA_helicase [PF00910], Evalue: 0.0067, Aligned region: 647..669
DUF2075 [PF09848], Evalue: 0.007, Aligned region: 221..322
DUF2075 [PF09848], Evalue: 0.007, Aligned region: 373..391
DUF2075 [PF09848], Evalue: 0.007, Aligned region: 646..677
Ras [PF00071], Evalue: 0.0072, Aligned region: 221..234
Ras [PF00071], Evalue: 0.0072, Aligned region: 647..688
DUF815 [PF05673], Evalue: 0.0098, Aligned region: 217..265
DUF815 [PF05673], Evalue: 0.0098, Aligned region: 640..678
Protein Sequence: 903 a.a.     [Download]
>gi|470479716|ref|YP_007640460.1| ClpV protein [Psychromonas sp. CNPT3]
MIRIELPTLIGKLNAQTKLALEQAASVCISRQNSEVTFEHLLFSLLENPLSDVRVLIKQAGLDHDVLKQK
IGAVMARSNDSHETYPAFSPLLVELLQDAWLLSSIELNETELRSGAIFLAALLRSDRYLEFSLHDLLKSF
NCETLRKNFSILTSGSTESPAPLDTSKSVSVLNDSTTALSRFCCNFTEQARKGELDPVICRDAEINLMID
ILCRRRKNNPIVVGDAGVGKSAVVEGLALRIVENKVPESLRDVELMSLDLGRLQAGASVKGEFEKRLKGL
IDEVKASSTPIILFIDEAHTLIGAGNQDGNDAANLLKPALARGELCTIAATTWKEYKKYFEKDPALNRRF
QLVKLDEPSVEQAVDILRGLHQVYEKAHKVLISDEALRAAAELSARYVSGRQLPDKAIDVLDTACARIAI
NLSSPPRRIGELENICYQRQLEINMLNRQKKLARNIDEERLDELLKLEVETRALIKKLHDAWEIQREVVE
KVIIIRQSILDDSVAISTGIDSDTDSDTDTDVSVETESTNIAVESASIAPQKKTPEQENELREQLKSLYA
ELAAIPHSEVLMHPEVDAEQIAEVIADWTGVPVEQMNADELTKITNLPQLLGATIKGQDTALATIHRHML
TSRADLRRPGRPKGAFLLVGPSGVGKTETVLQLAEKLYGGRQFLTTINMSEYQEKHTVSRLIGSPPGYVG
FGEGGVLTEAIRKMPYSIVLLDEVEKAHPDVLNLFYQAFDKGEMADGEGRLIDCQNIVFFLTSNLAYQSI
VDHRIETGIIEDKIYPELAAFFKPALLARMEVVVYRPLGESILKQIICGKLSRLETLFMSRYKAEVKIDD
SLIDEILRRSTRSENGARMLEAIIEGQMLPAISLALLNKLAAREDVHRIYLTVKDGEFFGEVE
 
Nucleotide Sequence: 2712 bp     [Download]
>gi|470478036|ref|NC_020802.1|:c1993992-1991281 Psychromonas sp. CNPT3, complete genome
GTGATAAGAATCGAACTGCCAACATTAATTGGTAAATTAAATGCGCAAACGAAGCTTGCTTTAGAGCAAG
CTGCATCGGTATGTATTAGTCGTCAAAATTCAGAAGTAACATTTGAGCATTTGCTTTTTAGTTTACTTGA
AAATCCATTATCGGATGTTCGAGTATTAATTAAACAAGCGGGTCTAGATCATGATGTTCTAAAGCAAAAG
ATTGGTGCAGTGATGGCTCGTAGTAACGATAGTCACGAGACTTACCCCGCTTTTTCGCCATTATTAGTTG
AATTATTACAAGATGCGTGGTTATTAAGCTCAATTGAACTTAATGAGACAGAGCTACGTTCAGGGGCTAT
TTTTTTAGCCGCGTTATTACGCTCGGATCGTTACTTAGAATTTAGCTTACATGATTTATTAAAATCTTTT
AATTGTGAGACGTTGCGTAAGAATTTTTCGATCTTAACCTCTGGCTCTACAGAGTCTCCAGCTCCGCTCG
ATACGTCTAAATCAGTATCGGTATTGAATGATTCAACGACTGCTTTATCACGTTTTTGTTGTAATTTTAC
TGAGCAAGCACGAAAAGGTGAGTTAGATCCGGTGATATGCCGGGATGCTGAAATTAACTTAATGATTGAT
ATATTGTGTCGTCGTCGTAAAAATAATCCTATTGTAGTAGGCGATGCAGGTGTAGGTAAAAGTGCTGTTG
TCGAAGGCTTAGCATTGCGTATTGTTGAAAATAAAGTGCCGGAGTCATTGCGTGACGTTGAATTAATGTC
ATTGGATTTGGGACGTTTGCAAGCGGGAGCGTCGGTAAAAGGTGAATTTGAAAAACGTTTAAAAGGGCTT
ATTGATGAAGTAAAAGCATCATCAACACCGATAATTTTATTTATAGATGAGGCGCATACTTTAATAGGAG
CGGGTAATCAAGATGGTAATGATGCGGCGAACTTATTGAAACCAGCACTTGCCCGAGGTGAATTATGTAC
GATAGCGGCCACTACTTGGAAAGAATACAAAAAATATTTTGAAAAAGATCCCGCCTTAAATCGTCGTTTT
CAACTCGTAAAATTAGATGAGCCTAGCGTAGAGCAAGCGGTGGATATTTTACGTGGTTTGCATCAAGTTT
ATGAGAAAGCGCATAAGGTACTTATCAGTGATGAGGCGCTTCGAGCTGCCGCTGAGCTATCGGCTCGTTA
CGTATCGGGTCGTCAACTTCCCGATAAAGCGATTGATGTACTTGATACTGCCTGTGCTCGTATAGCAATT
AATTTGAGCTCTCCTCCTCGTCGCATTGGCGAACTTGAAAATATTTGTTATCAACGCCAACTTGAAATTA
ACATGTTAAATCGTCAAAAAAAGTTAGCTCGAAATATTGATGAAGAGCGTTTAGACGAATTATTAAAATT
AGAAGTAGAGACGCGAGCATTGATTAAAAAGTTGCATGATGCTTGGGAGATACAGCGTGAAGTAGTTGAG
AAAGTGATTATTATCCGCCAAAGTATTTTAGATGATAGTGTTGCGATATCGACAGGTATTGATAGCGATA
CAGATAGCGATACAGATACCGATGTTAGCGTTGAAACAGAATCGACTAACATTGCAGTTGAAAGTGCATC
TATTGCGCCACAAAAAAAGACGCCAGAGCAAGAGAATGAGTTACGTGAACAGTTAAAGAGTCTATATGCA
GAGCTTGCCGCTATCCCTCATAGCGAAGTGTTAATGCACCCGGAAGTAGATGCAGAGCAAATAGCAGAGG
TCATTGCGGATTGGACGGGTGTACCCGTTGAGCAAATGAATGCAGACGAACTCACTAAAATAACTAATTT
ACCGCAGTTACTCGGTGCAACAATAAAAGGTCAAGATACTGCACTCGCTACAATTCATCGACATATGTTA
ACTTCACGTGCAGATTTGCGTCGACCAGGTAGACCCAAAGGTGCTTTTTTATTAGTGGGTCCAAGTGGAG
TAGGAAAAACAGAAACTGTTTTGCAATTAGCTGAAAAGTTATATGGCGGACGGCAATTTCTGACCACAAT
AAACATGTCAGAATATCAAGAAAAGCATACTGTATCTCGTTTAATCGGTTCGCCTCCTGGTTATGTTGGT
TTTGGTGAAGGTGGCGTATTAACCGAAGCTATTCGTAAAATGCCATATTCAATTGTTTTACTTGATGAAG
TCGAAAAGGCACACCCTGATGTATTAAATTTATTTTACCAAGCATTTGATAAAGGTGAGATGGCTGATGG
TGAAGGTCGCTTGATTGATTGTCAAAATATTGTTTTCTTTTTAACTTCAAATTTGGCTTATCAAAGCATT
GTTGACCATCGCATTGAAACAGGAATAATTGAAGATAAAATTTATCCTGAGTTGGCGGCTTTCTTTAAAC
CTGCGTTACTCGCACGCATGGAAGTTGTTGTCTATCGACCACTTGGAGAGTCTATTTTAAAACAAATAAT
TTGTGGAAAATTATCTCGTTTAGAAACGTTATTTATGAGTCGTTATAAGGCTGAAGTAAAAATAGATGAC
TCCTTAATAGATGAAATTTTGCGTCGTTCAACACGTTCTGAAAATGGTGCTCGAATGTTAGAAGCCATTA
TTGAAGGTCAAATGTTACCTGCAATATCACTTGCATTATTAAATAAATTAGCGGCTCGTGAAGATGTACA
TCGTATTTATTTGACAGTGAAAGACGGCGAGTTTTTTGGTGAAGTGGAGTAA