SecReT6
Protein ID: 470479717
SecReT6 ID741
T6SS typei1
Gene symbol-
Locus tagPCNPT3_08425
StrainPsychromonas sp. CNPT3
Repliconchromosome [GenBank: NC_020802] [Browse all T6SS(s) in this replicon]
Location [Strand]1994004..1994795 [-]
ProductDotU
NoteTssL
UniProt IDM4U5E5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 6.60E-66, Aligned region: 42..247
Protein Sequence: 263 a.a.     [Download]
>gi|470479717|ref|YP_007640461.1| DotU [Psychromonas sp. CNPT3]
MADVLFDEPTSLESYNNLLFDEVSKIDADQDYWFKLRGDNINPLIDAATPLMGMALRVRGLSTCDNVYDI
YKQAVEEVKAIEVELKEAGYERAVIISYRYVLCSFIDEAVMNTAWGADSIWIENSLLSRFHNETWGGEKV
FIILNRLEGEPTRYKELLEFIFLSFCLGFEGQYRVMSNGRDEYDKVVANLYAILRRIQENEPEELTHATK
HVITTKYNISRQIPLPIVFSGFLVTCVVIFIGYSLLLHTKSTDVLEQLNQILQ
 
Nucleotide Sequence: 792 bp     [Download]
>gi|470478036|ref|NC_020802.1|:c1994795-1994004 Psychromonas sp. CNPT3, complete genome
ATGGCAGATGTATTATTTGATGAACCGACCTCATTGGAGAGTTATAACAATTTGCTTTTTGATGAAGTCA
GTAAAATAGACGCAGATCAAGACTATTGGTTTAAGTTGCGTGGTGACAATATTAACCCTTTAATTGATGC
AGCTACGCCTTTGATGGGTATGGCGTTACGCGTAAGAGGATTATCAACTTGTGACAATGTTTATGATATT
TACAAGCAAGCCGTTGAAGAAGTAAAGGCGATTGAAGTTGAGTTAAAAGAGGCGGGTTATGAGCGTGCAG
TGATAATTTCTTACCGTTATGTTCTGTGTTCATTTATAGATGAAGCAGTGATGAATACAGCATGGGGCGC
CGATAGTATTTGGATTGAAAACTCATTACTTAGCCGTTTTCACAATGAAACGTGGGGCGGAGAGAAAGTA
TTCATTATTTTGAATCGTCTCGAAGGGGAACCTACGCGTTATAAGGAGCTTTTAGAGTTTATATTCTTAT
CTTTTTGTCTTGGTTTTGAAGGTCAATACCGAGTAATGAGTAACGGGCGAGATGAGTATGACAAAGTGGT
TGCGAATTTATATGCAATATTACGTCGCATACAAGAAAACGAACCGGAAGAGCTGACGCATGCAACAAAA
CATGTGATAACGACAAAATATAATATAAGTCGTCAAATACCTTTACCGATAGTGTTTTCCGGGTTTTTAG
TGACTTGCGTGGTTATTTTTATAGGCTATTCGTTGTTATTACACACTAAATCAACGGATGTATTAGAGCA
ACTAAATCAAATACTACAATAA