SecReT6
Protein ID: 470479718
SecReT6 ID741
T6SS typei1
Gene symbol-
Locus tagPCNPT3_08430
StrainPsychromonas sp. CNPT3
Repliconchromosome [GenBank: NC_020802] [Browse all T6SS(s) in this replicon]
Location [Strand]1994799..1996133 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDM4U5T9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.10E-159, Aligned region: 19..443
Protein Sequence: 444 a.a.     [Download]
>gi|470479718|ref|YP_007640462.1| type VI secretion protein [Psychromonas sp. CNPT3]
MSARNRVVWSEGLFIKPQHFQQQQRYTEHLIDVRIGSVSRYLYGITEILLNPEYLSFGRIAIERAVGVMP
DGTIFYIPQEDMLPKALEIVDSSFANQIVYLAISLRTDSITEISWPDSAGGGRYQLVRHEARDIHTQQGD
TTNIDVSSVSVRLMLEKEDRSAYASIAIARILEKRPDGSVVLDTNFIPCHLNVSGVPVLHRFIGEMAGLM
RERAKNIAQRIGSPSQGGVADVSDFMLLQALNRMQPQLQHLSNLRSLHPERLYESLSAMCGELSSFTDES
RLAPEFVSYNHDMPLESFLSVMSMLRQSLSIVLEPRAVSLQLHKRKYGIMVAPVQDPSLLRDADFILSVR
AKMPLDELRKLFIQQTKVASVEKIRELISLQLPGIPIIALPVAPRQLPYHAGYTYYQLDKTNPAWKMINN
SSGFAFHVAGDLPDLDLQFWAIRS
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|470478036|ref|NC_020802.1|:c1996133-1994799 Psychromonas sp. CNPT3, complete genome
ATGTCTGCAAGAAATAGAGTTGTTTGGAGTGAGGGCTTGTTTATTAAGCCACAACATTTTCAGCAACAGC
AACGTTATACAGAGCATCTAATTGATGTACGCATTGGATCTGTCAGTCGTTACCTGTATGGGATCACTGA
AATATTATTAAATCCAGAATATTTAAGTTTTGGTCGTATTGCAATAGAGCGAGCTGTGGGAGTGATGCCT
GACGGTACTATATTTTATATCCCACAAGAAGATATGTTACCCAAAGCATTAGAAATTGTTGATAGCTCAT
TTGCGAATCAAATCGTATATTTAGCTATTTCCTTACGCACAGATTCAATTACTGAGATAAGCTGGCCTGA
TAGCGCAGGAGGCGGGCGCTATCAATTAGTCCGTCATGAAGCGCGAGATATTCATACCCAGCAAGGCGAT
ACAACAAACATTGATGTTAGCTCTGTCTCTGTCCGCTTAATGTTAGAGAAAGAAGATAGAAGTGCATATG
CGTCTATTGCTATTGCACGTATTTTAGAAAAACGTCCTGATGGTAGTGTGGTGTTAGATACAAATTTTAT
CCCTTGCCACTTAAATGTTTCTGGCGTGCCAGTATTACACCGTTTTATAGGTGAAATGGCAGGTTTAATG
CGTGAACGCGCGAAGAATATAGCGCAACGTATAGGCTCGCCAAGTCAAGGAGGCGTTGCTGATGTATCTG
ATTTTATGTTGTTACAAGCTTTAAATCGAATGCAACCACAATTACAACATTTATCGAATTTACGTAGCCT
TCACCCCGAACGTTTGTATGAAAGTTTGAGTGCTATGTGTGGAGAGCTTTCTTCATTTACAGATGAAAGT
CGATTAGCGCCTGAATTTGTTAGTTACAACCATGATATGCCATTAGAGTCTTTTTTATCGGTGATGTCGA
TGTTACGTCAATCACTGAGTATTGTTCTTGAGCCCCGCGCCGTTTCGTTGCAATTACACAAACGCAAATA
TGGCATCATGGTAGCACCAGTACAAGATCCCTCATTATTACGTGATGCTGATTTTATTTTATCTGTGCGC
GCTAAAATGCCACTTGATGAGTTACGCAAATTATTTATTCAACAGACCAAAGTCGCCTCCGTTGAAAAAA
TTCGTGAGTTGATATCATTGCAATTACCGGGGATACCTATAATTGCACTACCGGTTGCCCCTCGTCAACT
TCCCTATCATGCTGGCTACACTTATTATCAATTAGATAAGACAAATCCCGCATGGAAAATGATCAACAAT
TCGAGTGGTTTTGCATTTCATGTAGCGGGAGATTTACCTGATCTTGATCTGCAGTTCTGGGCAATAAGGA
GTTAA