SecReT6
Protein ID: 470479719
SecReT6 ID741
T6SS typei1
Gene symbol-
Locus tagPCNPT3_08435
StrainPsychromonas sp. CNPT3
Repliconchromosome [GenBank: NC_020802] [Browse all T6SS(s) in this replicon]
Location [Strand]1996136..1996609 [-]
Producthypothetical protein
NoteTssJ
UniProt IDM4UMB7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 6.10E-38, Aligned region: 15..151
Protein Sequence: 157 a.a.     [Download]
>gi|470479719|ref|YP_007640463.1| hypothetical protein PCNPT3_08435 [Psychromonas sp. CNPT3]
MIGRLIIVAMLSTQLFACSSTYDPKIQPSTVTYSMVASATVNPNLSGEGTLIEVQVFELEDDSMFLNADY
DQLIKDTKSALKSNYIDHSDYALLPGQFKYIDTKKIDEDTHYIGVIARYSDPDKSQWKKVLKVKPLGQEY
HLLMLFQENEVNLNIEN
 
Nucleotide Sequence: 474 bp     [Download]
>gi|470478036|ref|NC_020802.1|:c1996609-1996136 Psychromonas sp. CNPT3, complete genome
ATGATCGGTCGTTTAATCATTGTCGCTATGTTATCAACGCAGTTGTTTGCATGTAGTTCGACTTATGATC
CGAAAATACAGCCTAGCACGGTGACGTATAGCATGGTTGCTAGTGCGACTGTGAATCCAAATCTCAGTGG
AGAAGGTACCCTAATTGAAGTTCAAGTTTTCGAATTAGAAGACGATTCAATGTTTTTAAATGCAGATTAT
GACCAATTAATTAAAGATACCAAGAGTGCGTTAAAAAGCAACTATATAGATCATTCTGATTATGCTTTAT
TACCCGGTCAATTTAAGTACATAGACACGAAAAAAATAGATGAAGATACTCATTATATCGGTGTAATTGC
GCGTTATTCAGATCCTGATAAGAGTCAATGGAAAAAAGTATTGAAAGTGAAGCCGTTAGGGCAGGAATAC
CATTTGTTAATGCTTTTTCAAGAAAATGAAGTTAACTTAAATATCGAGAATTAA