SecReT6
Protein ID: 470479720
SecReT6 ID741
T6SS typei1
Gene symbol-
Locus tagPCNPT3_08440
StrainPsychromonas sp. CNPT3
Repliconchromosome [GenBank: NC_020802] [Browse all T6SS(s) in this replicon]
Location [Strand]1996611..1998119 [-]
Producttype VI secretion system protein ImpI
NoteFha
UniProt IDM4U7M6
KEGG IDpsy:PCNPT3_08440
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.40E-05, Aligned region: 34..100
Protein Sequence: 502 a.a.     [Download]
>gi|470479720|ref|YP_007640464.1| type VI secretion system protein ImpI [Psychromonas sp. CNPT3]
MAELRSVTLVVINSQLLQAGLSATHKFSVEGGSIGGDFDADWQLQDDKNSVHSLHCNIFFTDTFFCLNDN
CGSTYINDASMPIGKNKVVKLNKKDVLNIGIYQIRVHFDDKYTDAKILDLDGEDTLDIDIHSHKLLFTNE
TKNEIKNNDDPLKALDSVERELSSKFSGADSKQTKEKIEQDNVDYLLAKDHGKQGASIMMQADCERDESA
AIYLKTESKEKSKSSAIETPLNCNTKGIFRSKLLSSYRQLMGSESLHTTNSNMAQKDSAMNDKVLDLLED
DIDDIDEIDDNFNLYEGDSALDNGVNHLVAAPLLRGLGVQTGDLNNLGEMQILSEEIGASLQAAIKGLLE
LHSQVENSRYGVMNKNLQPIEDNPLRLGLSYEQTVQTMFDVKRSLVHLSAPSSIAESLQTVKHHNESVQM
ATSDALNQILHAFSPEVLTRRFNRYKRTGERINESEDAWAWKMYQSYYSELTSNRQNGFEKLFWEIFDQA
YDKTLREKQQEE
 
Nucleotide Sequence: 1509 bp     [Download]
>gi|470478036|ref|NC_020802.1|:c1998119-1996611 Psychromonas sp. CNPT3, complete genome
ATGGCAGAATTGCGTAGCGTTACATTGGTAGTGATCAATTCTCAGTTACTACAGGCTGGGTTATCTGCAA
CACATAAATTTAGTGTTGAAGGAGGCTCCATTGGTGGGGATTTTGATGCGGATTGGCAGTTACAAGATGA
TAAAAACAGTGTGCATAGCTTGCATTGTAATATTTTTTTTACAGATACTTTCTTTTGTTTAAATGACAAT
TGTGGGAGCACTTATATAAATGATGCTTCAATGCCTATTGGCAAGAATAAAGTTGTAAAACTTAATAAAA
AAGATGTTCTAAACATTGGTATTTATCAAATACGAGTGCACTTCGATGATAAATATACAGATGCAAAAAT
ATTAGATTTAGACGGTGAAGATACGTTAGATATTGATATTCATAGTCATAAATTATTATTTACAAATGAA
ACTAAAAACGAAATAAAAAATAATGATGATCCGTTAAAAGCGTTAGATAGCGTTGAACGGGAGCTTTCTA
GTAAATTTTCTGGCGCGGATTCGAAGCAAACAAAAGAGAAAATAGAACAAGATAATGTTGACTATTTATT
AGCGAAAGATCATGGAAAGCAGGGTGCAAGTATAATGATGCAAGCAGATTGTGAGCGTGATGAAAGTGCT
GCCATTTACTTAAAAACCGAATCTAAAGAAAAAAGTAAAAGTTCGGCAATAGAAACACCGTTAAATTGTA
ACACAAAAGGCATTTTCAGATCTAAGTTATTGTCTTCTTATCGACAACTAATGGGCTCTGAATCATTACA
TACTACAAACAGTAATATGGCACAAAAGGATAGCGCAATGAACGATAAAGTACTCGATTTATTAGAAGAT
GACATAGATGACATAGATGAGATAGATGATAATTTTAATTTATATGAAGGTGATAGCGCATTAGATAACG
GAGTTAATCACCTTGTCGCGGCGCCTTTATTACGAGGTTTAGGGGTACAAACGGGTGATCTTAATAATTT
GGGCGAAATGCAAATTTTATCGGAAGAAATAGGAGCTTCGTTACAAGCTGCCATTAAAGGTTTATTAGAG
TTACATTCACAAGTAGAAAATAGCCGTTATGGCGTCATGAATAAGAACTTGCAACCCATTGAAGATAATC
CATTACGTCTAGGGTTATCTTATGAACAGACAGTGCAGACTATGTTTGATGTAAAGCGTAGTTTAGTGCA
CTTATCTGCACCTTCTTCGATTGCTGAAAGTTTGCAAACAGTAAAGCATCATAATGAATCTGTGCAAATG
GCGACCAGTGATGCTTTAAATCAAATTTTACACGCTTTTTCACCGGAAGTATTAACGCGTCGCTTCAATC
GCTATAAGCGTACAGGCGAGCGAATAAATGAAAGTGAGGATGCTTGGGCATGGAAGATGTATCAAAGTTA
TTACAGTGAATTGACCTCAAATCGTCAAAATGGCTTCGAAAAGTTATTTTGGGAGATTTTTGATCAAGCA
TACGATAAAACATTACGTGAGAAACAGCAGGAGGAATAA