SecReT6
Protein ID: 470479721
SecReT6 ID741
T6SS typei1
Gene symbol-
Locus tagPCNPT3_08445
StrainPsychromonas sp. CNPT3
Repliconchromosome [GenBank: NC_020802] [Browse all T6SS(s) in this replicon]
Location [Strand]1998128..1999135 [-]
Producthypothetical protein
NoteTssG
UniProt IDM4U8X9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 8.60E-94, Aligned region: 23..321
Protein Sequence: 335 a.a.     [Download]
>gi|470479721|ref|YP_007640465.1| hypothetical protein PCNPT3_08445 [Psychromonas sp. CNPT3]
MGHANRDATSDLESATIDIQLPKQVESYNFYQLVELLHRLQDEEPESENWELRCRLLFSANPSLGFASSD
VTKVESMDNGRIKLETTFFGLTGSQSPLPGFFLERIATEDENGLRKEFLDFFNNRLLALLYRVWRKYRYY
VRFKENASDDFSAQLFALVGLADKELRGDTPINWCKMLSYAGMLAGRSRSPQVVSGIVAHCFDLSDVSIR
QWEVRKVRIPENQRMQLGRANVQLGNDTIIGEDVKDCMGKFVICVKNMTQMRFKDFLPSGKEYLPFCKLI
EFILREQMAFDLELELKADEALPMQLGGQGQFSLGWSSFIGTSTEKRRVRIQIRR
 
Nucleotide Sequence: 1008 bp     [Download]
>gi|470478036|ref|NC_020802.1|:c1999135-1998128 Psychromonas sp. CNPT3, complete genome
ATGGGGCACGCAAATAGGGATGCAACCTCTGATTTAGAGAGTGCAACAATAGACATACAATTACCAAAGC
AGGTTGAATCTTACAATTTTTATCAACTGGTTGAATTATTACATCGTCTTCAAGATGAAGAGCCAGAAAG
TGAAAATTGGGAGTTACGTTGTCGTCTTTTATTTAGCGCAAATCCCAGCTTAGGTTTTGCCTCTAGTGAT
GTTACAAAAGTAGAGTCAATGGATAACGGACGCATTAAATTAGAGACCACTTTTTTTGGATTAACGGGAT
CTCAATCTCCATTACCCGGTTTTTTTTTAGAGCGCATTGCAACAGAAGATGAAAACGGATTACGCAAAGA
ATTTTTAGATTTTTTTAATAATCGTTTACTTGCTTTATTGTATCGAGTTTGGAGGAAATATCGTTATTAC
GTGCGATTTAAAGAAAATGCTAGTGATGATTTTTCAGCTCAGCTATTTGCATTAGTCGGATTAGCAGATA
AAGAACTACGTGGCGACACGCCTATTAATTGGTGCAAAATGTTGTCTTATGCCGGGATGTTAGCGGGTCG
AAGTCGTTCCCCACAAGTTGTGTCTGGGATTGTTGCACATTGTTTTGATTTATCTGATGTCAGTATTCGA
CAGTGGGAGGTCCGAAAAGTAAGGATCCCTGAAAATCAAAGAATGCAATTGGGAAGAGCGAATGTACAAC
TAGGCAATGACACTATTATTGGAGAGGATGTTAAAGATTGTATGGGTAAATTTGTCATTTGTGTAAAAAA
CATGACACAAATGCGTTTTAAAGATTTTCTTCCTTCAGGTAAAGAATATTTACCTTTTTGTAAGTTAATT
GAATTTATTTTACGTGAACAGATGGCCTTTGATTTAGAGCTTGAATTAAAAGCAGATGAAGCGCTTCCAA
TGCAATTGGGGGGGCAGGGTCAATTTTCACTTGGTTGGTCATCTTTTATTGGTACGAGTACAGAAAAAAG
ACGAGTTAGAATTCAAATTAGACGTTAG