SecReT6
Protein ID: 470479722
SecReT6 ID741
T6SS typei1
Gene symbol-
Locus tagPCNPT3_08450
StrainPsychromonas sp. CNPT3
Repliconchromosome [GenBank: NC_020802] [Browse all T6SS(s) in this replicon]
Location [Strand]1999099..2000811 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDM4U5F0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.90E-187, Aligned region: 2..570
Protein Sequence: 570 a.a.     [Download]
>gi|470479722|ref|YP_007640466.1| type VI secretion protein [Psychromonas sp. CNPT3]
MEFSEVYPQLSRFLHGRTTDPDVERLLEGFAFLTGRLREKVEDDFPELTHSIINMLWPNYLRPVPSISII
KFNPKIKAISSRQTVLKGTRLDSLLVSDTICHFSTCRDLDIYPLERESVVTTHTREASIIDVNLCLLGDQ
NVSKMKLDNLRFYLGGHNYSAQMLYLWLSHYLQRIDVIAGDSTFTLPKGSFQVVGFDGKDAILPYPKNVY
EGYRILQEYLVFQDAFLFFDVMSIGKNIAPTVSGKMTLRFCFSRTLPADVRVRDKSFELYCTPAINIFEH
DADPIDLNGKKTEYKVTPSSRYPAHYEIFNVQRVQGWKGSETGRVRGEPRIYSPFESFQHEIERSRDRQS
LYYRVRVKNSLRNDGFDHYISFVRGDETQCIGLSEAISLHLICTNRQLPLELGRGDICVATDSSPAYASF
ENITEPTQPLRPVLDGSLLWTLISNLSLNYLSLLSRDALCSILRAYDFRSLVDRQAELIAKQRLQGIVKI
TSQPIEKIIRGLPVRGLQSVIELDQTSFGSEGDLYLFGSVLSRFFALYASINSFHELVVINSVNQEKYTW
GTQIGMQPLI
 
Nucleotide Sequence: 1713 bp     [Download]
>gi|470478036|ref|NC_020802.1|:c2000811-1999099 Psychromonas sp. CNPT3, complete genome
ATGGAGTTTTCAGAGGTTTACCCTCAACTTTCTCGTTTTTTACATGGCCGAACAACTGATCCTGATGTTG
AGCGACTATTAGAAGGTTTTGCCTTTTTAACGGGGCGTTTACGTGAGAAAGTTGAGGATGATTTTCCTGA
ATTAACTCATTCTATTATTAATATGTTGTGGCCAAACTATTTAAGGCCAGTACCAAGTATTAGTATTATT
AAATTTAATCCAAAGATAAAAGCGATTAGTTCACGGCAGACAGTATTAAAGGGAACGCGTCTTGATAGTT
TACTTGTATCGGATACTATTTGTCATTTTAGCACCTGCCGTGATTTAGATATTTACCCGTTAGAGCGTGA
GAGTGTGGTAACAACTCATACTCGTGAAGCCTCAATAATTGATGTTAATTTATGTTTGTTAGGTGATCAA
AACGTCAGCAAAATGAAACTTGATAATTTACGTTTTTATTTAGGTGGGCATAATTATAGTGCACAAATGT
TGTATTTATGGCTCAGTCATTATTTACAACGAATTGATGTTATTGCGGGAGATAGCACTTTTACTTTACC
TAAAGGTAGTTTTCAAGTTGTTGGTTTTGATGGTAAGGATGCTATTTTACCCTACCCTAAAAATGTTTAT
GAAGGTTATCGTATTTTACAGGAATACTTAGTATTTCAAGATGCTTTTTTATTTTTTGATGTGATGTCAA
TTGGCAAAAATATTGCACCAACAGTCTCAGGGAAAATGACGTTACGTTTTTGTTTTTCAAGAACGTTACC
AGCTGATGTGCGCGTTCGGGATAAAAGTTTTGAGCTGTATTGTACGCCTGCGATTAATATTTTTGAGCAT
GATGCTGATCCCATTGATCTAAACGGCAAAAAGACAGAATACAAAGTTACTCCCTCAAGTCGTTACCCCG
CGCATTATGAAATTTTTAATGTACAAAGAGTGCAAGGTTGGAAGGGCTCTGAGACAGGTAGAGTGCGTGG
AGAACCAAGAATTTATAGTCCATTTGAAAGTTTTCAACATGAAATTGAACGTAGTCGTGATCGTCAATCG
TTATATTATCGAGTACGCGTAAAAAACAGCTTACGTAATGACGGTTTTGATCATTACATTTCATTTGTTC
GTGGTGATGAAACGCAATGTATAGGTCTTAGTGAAGCGATTTCTCTGCATCTTATTTGTACTAATCGTCA
ACTTCCTTTGGAGTTAGGTCGAGGTGATATTTGTGTCGCAACGGACTCATCACCTGCTTATGCAAGCTTT
GAAAATATCACTGAACCAACTCAGCCATTACGGCCTGTATTAGATGGCAGTTTGTTATGGACTTTAATTT
CAAATTTATCATTAAATTATTTATCGTTACTTTCTCGTGATGCTTTGTGCTCTATTTTGCGTGCTTATGA
TTTTAGGTCATTAGTAGATCGTCAAGCTGAATTAATCGCTAAGCAACGCTTACAAGGAATTGTAAAAATC
ACATCGCAACCGATAGAGAAAATTATTCGAGGATTACCGGTTCGAGGTTTGCAATCGGTAATTGAATTAG
ATCAAACTTCATTTGGATCTGAAGGTGATTTGTATTTGTTTGGATCGGTACTAAGTCGATTTTTTGCATT
ATACGCAAGTATTAATTCGTTTCATGAATTGGTAGTTATTAACTCTGTAAATCAGGAAAAATATACATGG
GGCACGCAAATAGGGATGCAACCTCTGATTTAG