SecReT6
Protein ID: 470479723
SecReT6 ID741
T6SS typei1
Gene symbol-
Locus tagPCNPT3_08455
StrainPsychromonas sp. CNPT3
Repliconchromosome [GenBank: NC_020802] [Browse all T6SS(s) in this replicon]
Location [Strand]2000868..2001305 [-]
Producthypothetical protein
NoteTssE
UniProt IDM4U5U4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.30E-22, Aligned region: 36..125
Protein Sequence: 145 a.a.     [Download]
>gi|470479723|ref|YP_007640467.1| hypothetical protein PCNPT3_08455 [Psychromonas sp. CNPT3]
MSYIVLEDSAYGVSLFERLEKDAPMRSIMKGPDPGDVLDSIKRNISDLLNTRMGEAQSAPNLGLIDFNDA
TLGSNDLALQIKLAIFECIERYEPRIKEMDIHILADDDSPLNLRFHITASLNSSAIDKKIQIDLLLDNNK
NYRVI
 
Nucleotide Sequence: 438 bp     [Download]
>gi|470478036|ref|NC_020802.1|:c2001305-2000868 Psychromonas sp. CNPT3, complete genome
ATGTCTTATATAGTACTCGAAGATAGCGCATATGGCGTTAGTTTGTTTGAGCGATTAGAAAAAGATGCTC
CTATGCGTTCGATTATGAAAGGTCCTGATCCTGGTGACGTTTTAGACTCTATTAAACGTAACATCAGCGA
TTTATTAAACACACGTATGGGTGAAGCGCAAAGTGCTCCAAACTTGGGTTTGATTGATTTTAATGATGCA
ACTTTAGGCAGTAATGATTTAGCTTTACAAATTAAACTCGCTATTTTCGAGTGCATTGAACGTTATGAAC
CTCGTATAAAAGAAATGGATATTCATATTTTAGCGGATGATGATAGTCCGCTAAATCTGCGTTTTCATAT
TACAGCGAGTTTGAATAGTAGTGCTATCGACAAAAAAATTCAAATAGATCTTTTATTAGATAACAACAAA
AATTATAGAGTGATTTAA