SecReT6
Protein ID: 470479724
SecReT6 ID741
T6SS typei1
Gene symbol-
Locus tagPCNPT3_08460
StrainPsychromonas sp. CNPT3
Repliconchromosome [GenBank: NC_020802] [Browse all T6SS(s) in this replicon]
Location [Strand]2001312..2002793 [-]
Producthypothetical protein
NoteTssC
UniProt IDM4UMC2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.40E-188, Aligned region: 66..491
Protein Sequence: 493 a.a.     [Download]
>gi|470479724|ref|YP_007640468.1| hypothetical protein PCNPT3_08460 [Psychromonas sp. CNPT3]
MSNQEQEQVLKQAEVSQMSLLDEIMAQTRIEPSEDGYDIAKKGIAAFIENLIGSKQTDEQVNKSLVDHMI
VDLDNKISAQMDEILHNESVQTLESSWRGLKLLIDRTDFRENIKVEVLHATKQEMLDDFEFAAETVQSGL
YQHIYSSGYGQFGGEPVGAIIGNYAFTPSSPDIKLLQYIGAVAAMAHAPFISSVAPSFFGIDSFEELPNI
KDLKSIFESPRYTKWRALRDSEDARYLGLTTPRFLLRVPYDPIESPIRSFNYSENVSDSHDSYLWGNTAF
SFGTRLTDSFANYRWCPNIIGPQSGGAVEDLPVHMFESMGALQSKISTEVLITDRKEFELAEEGFIALTM
RKGSDNAAFFSANSIQKPKVFPNTKEGREAETNYKLGTQLPYMMIINRLAHYVKVLQREQIGAWKERQDL
ERELNGWIKQYVADQENPPAEVRSRRPLRAAKIEVSDVEGDPGWYQVSLSVRPHFKYMGANFELSLVGRL
DKV
 
Nucleotide Sequence: 1482 bp     [Download]
>gi|470478036|ref|NC_020802.1|:c2002793-2001312 Psychromonas sp. CNPT3, complete genome
ATGTCAAATCAAGAGCAAGAGCAAGTGCTCAAACAAGCTGAAGTTAGTCAAATGAGTTTACTTGATGAAA
TAATGGCGCAAACACGCATTGAACCCAGTGAAGATGGTTATGATATTGCGAAGAAAGGTATTGCCGCTTT
TATTGAGAATTTAATAGGTTCGAAACAAACTGATGAACAAGTTAATAAATCACTTGTAGATCATATGATT
GTTGATTTAGATAATAAAATAAGTGCGCAAATGGATGAGATTTTACACAATGAATCGGTCCAAACATTGG
AATCGTCATGGCGTGGTCTTAAATTATTAATTGATCGCACTGATTTTCGTGAAAACATCAAAGTAGAAGT
GCTTCATGCGACCAAGCAAGAAATGCTCGATGATTTTGAATTTGCAGCTGAAACTGTGCAATCTGGTTTA
TATCAACATATTTATTCATCGGGTTATGGGCAGTTTGGTGGAGAGCCCGTCGGAGCTATCATTGGTAATT
ATGCATTCACACCATCGAGTCCTGATATTAAGTTACTTCAGTACATTGGCGCTGTTGCCGCAATGGCTCA
TGCACCCTTTATATCATCAGTAGCACCTTCATTTTTTGGAATTGATTCATTTGAAGAGTTGCCTAATATT
AAAGATCTTAAATCTATATTTGAAAGCCCTCGTTACACTAAATGGAGGGCTTTACGAGATTCAGAAGATG
CACGTTATTTAGGCCTAACGACCCCAAGGTTCTTATTGCGAGTTCCTTATGATCCTATTGAAAGCCCTAT
TCGTTCGTTTAATTACAGTGAAAATGTGAGTGATTCTCATGATAGCTATTTGTGGGGAAATACCGCATTT
AGTTTTGGCACTCGTTTAACCGATAGCTTTGCAAATTATCGATGGTGTCCGAACATTATCGGTCCTCAAA
GTGGAGGGGCAGTTGAAGATCTTCCTGTGCATATGTTTGAATCAATGGGAGCATTACAATCTAAAATTTC
AACTGAAGTATTGATAACAGATCGTAAAGAATTCGAATTGGCAGAAGAGGGGTTTATTGCGTTAACGATG
CGAAAAGGCAGTGATAATGCAGCATTCTTTTCGGCTAACTCTATTCAAAAACCTAAAGTATTTCCAAATA
CGAAGGAAGGACGTGAAGCAGAAACCAATTATAAGTTAGGTACACAATTACCTTACATGATGATCATTAA
TCGTCTTGCGCATTATGTAAAAGTGTTACAACGCGAACAAATTGGAGCGTGGAAAGAGCGTCAAGATTTA
GAGCGTGAACTAAATGGTTGGATAAAGCAATATGTTGCAGATCAAGAAAATCCACCTGCAGAAGTTCGTA
GTCGTCGCCCACTTCGCGCAGCTAAAATTGAAGTGTCTGATGTTGAGGGAGATCCAGGTTGGTATCAAGT
GTCACTTTCCGTTCGTCCTCATTTCAAGTATATGGGGGCAAATTTTGAGCTGTCACTCGTTGGTCGTTTG
GATAAGGTGTAG