SecReT6
Protein ID: 470479725
SecReT6 ID741
T6SS typei1
Gene symbol-
Locus tagPCNPT3_08465
StrainPsychromonas sp. CNPT3
Repliconchromosome [GenBank: NC_020802] [Browse all T6SS(s) in this replicon]
Location [Strand]2002841..2003350 [-]
Producthypothetical protein
NoteTssB
UniProt IDM4U7N1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.10E-55, Aligned region: 6..158
Protein Sequence: 169 a.a.     [Download]
>gi|470479725|ref|YP_007640469.1| hypothetical protein PCNPT3_08465 [Psychromonas sp. CNPT3]
MSKEGSIAPKERINIKYVPATGDNQSEVELPLKIMVVGDFKGHGEEMTIEDRKAVSVNKNNFTSVMHENN
LTIKTTVVNKLSEENEGDLTVELSFKSLADFSPDSIAFQVPEINKLIELREALVALKGPLGNIPAFRSRL
QEIISSDESREKLLAEFKLVKEEPKQAQK
 
Nucleotide Sequence: 510 bp     [Download]
>gi|470478036|ref|NC_020802.1|:c2003350-2002841 Psychromonas sp. CNPT3, complete genome
ATGTCTAAAGAAGGAAGTATTGCTCCAAAGGAACGTATTAACATCAAATATGTTCCAGCTACGGGTGATA
ACCAATCAGAAGTTGAATTACCATTAAAAATAATGGTTGTAGGTGATTTTAAAGGTCATGGCGAAGAAAT
GACGATTGAAGATCGTAAGGCCGTGTCTGTTAATAAAAACAATTTTACATCGGTCATGCATGAAAATAAC
TTAACCATCAAGACGACTGTCGTAAATAAATTATCTGAAGAAAATGAAGGTGATTTGACTGTTGAATTAT
CTTTTAAATCTTTAGCCGATTTTTCTCCTGATTCAATTGCATTCCAAGTTCCAGAGATAAATAAGTTAAT
TGAATTACGTGAAGCCTTAGTTGCTCTGAAGGGTCCATTAGGTAATATTCCTGCTTTTCGTTCTCGTCTT
CAAGAGATAATTTCTTCGGATGAGTCACGCGAAAAGTTACTTGCAGAATTTAAACTTGTTAAAGAAGAGC
CTAAGCAAGCCCAAAAATAA