SecReT6
Protein ID: 471265712
SecReT6 ID742
T6SS typei3
Gene symbol-
Locus tagXCAW_00152
StrainXanthomonas citri subsp. citri Aw12879
Repliconchromosome [GenBank: NC_020815] [Browse all T6SS(s) in this replicon]
Location [Strand]191081..191590 [+]
ProductHypothetical Protein
NoteTssB
UniProt IDM4VT31
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.00E-59, Aligned region: 8..159
Protein Sequence: 169 a.a.     [Download]
>gi|471265712|ref|YP_007648177.1| Hypothetical Protein XCAW_00152 [Xanthomonas citri subsp. citri Aw12879]
MASSQKFIARNRAPRVQIEYDVEVYGAQKKVQIPFVMGVMSDLSGANAGELPSLDERKALEIDVDNFDSR
LQSMGPRAQFKVPNTLTGEGELAVDITFESMDDFSPAAIARKVAPLAKLLEARTQLANLDTYMDGKAGAE
QLIANAIRDPALLQSLVSAGKPASEPEGT
 
Nucleotide Sequence: 510 bp     [Download]
>gi|471265562|ref|NC_020815.1|:191081-191590 Xanthomonas citri subsp. citri Aw12879, complete genome
ATGGCCAGCAGTCAGAAGTTCATCGCCCGCAATCGGGCGCCACGGGTGCAGATCGAATACGACGTGGAGG
TCTACGGCGCGCAGAAGAAGGTGCAGATTCCGTTCGTGATGGGGGTGATGTCGGATCTGTCCGGCGCCAA
CGCCGGTGAGCTGCCCTCGCTGGATGAGCGCAAGGCACTGGAGATCGACGTCGACAACTTCGACAGCCGT
CTGCAGTCGATGGGCCCGCGCGCGCAATTCAAGGTGCCCAACACGCTCACCGGCGAAGGCGAGCTGGCGG
TGGATATCACCTTCGAAAGCATGGACGACTTTTCGCCGGCCGCCATCGCGCGCAAGGTTGCGCCGTTGGC
CAAATTGCTGGAAGCGCGCACGCAGTTGGCCAACCTGGACACCTACATGGACGGCAAGGCCGGTGCAGAG
CAGCTGATCGCCAACGCTATCCGCGATCCGGCGTTGCTGCAGTCGCTGGTGTCGGCCGGCAAGCCCGCGT
CCGAACCGGAAGGAACCTGA