SecReT6
Protein ID: 471265713
SecReT6 ID742
T6SS typei3
Gene symbol-
Locus tagXCAW_00153
StrainXanthomonas citri subsp. citri Aw12879
Repliconchromosome [GenBank: NC_020815] [Browse all T6SS(s) in this replicon]
Location [Strand]191594..193087 [+]
ProductType VI secretion protein, EvpB/VC_A0108 family
NoteTssC
UniProt IDM4VTJ6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.40E-193, Aligned region: 66..492
BMFP [PF04380], Evalue: 0.00066, Aligned region: 20..58
BMFP [PF04380], Evalue: 0.00066, Aligned region: 64..90
Protein Sequence: 497 a.a.     [Download]
>gi|471265713|ref|YP_007648178.1| Type VI secretion protein, EvpB/VC_A0108 family [Xanthomonas citri subsp. citri Aw12879]
MSATEAALATRSTETTERGDFAALLNREFRPKSERAKEEVESAVRTLAEQVLNRSDVVGEDVSQTIKAYI
AEIDRTLTEQLNQILHHADLQQLEGAWRGLHYLVNNTETDQQLKIRVLNISKKELGKVLKRYKGTAWDQS
PIFKKVYEQEYGQLGGEPYGCLVGDYYFDQSPPDVELLNGIAQVAAAAHAPFIAAAAPKLMGMDNWSELS
NPRDLAKIFSTPDYAAWRSLRESEDSKYIGLAMPRTLSRLPYGAATSPVEDFDFEEDTAGADSNKYTWQN
AAYAMAVNINRSFKQYGWCSRIRGIESGGAVEGLPTHTFPTDDGGVDMKCPTEVAITDRRSAELDKMGLM
PLVHRKNSDMAAFISAQSLNKPDEYDDPDATANAALGARLPYMFACCRFAHYLKCIVRDKIGSFSDREQM
QSWLTRWVTQYIDGDPSNSSEETKARKPLAAAEVVVEEVEGAPGYYSSKFFLKPHYQLEGLTVSLRLVSR
LPSAAKA
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|471265562|ref|NC_020815.1|:191594-193087 Xanthomonas citri subsp. citri Aw12879, complete genome
ATGTCCGCGACCGAAGCCGCACTGGCCACCCGTAGCACCGAAACAACCGAGCGGGGCGACTTTGCCGCGC
TGCTCAATCGCGAGTTCCGTCCCAAGAGCGAGCGCGCCAAGGAAGAAGTGGAATCGGCGGTGCGCACGCT
CGCCGAGCAGGTGCTCAACCGCAGCGATGTGGTTGGCGAAGACGTATCGCAGACCATCAAGGCCTACATC
GCCGAGATCGACCGCACGCTCACCGAACAGCTCAACCAGATCCTGCATCACGCCGATCTGCAACAGCTCG
AAGGCGCCTGGCGCGGCCTGCATTATCTGGTCAACAACACCGAGACCGACCAGCAGCTCAAGATCCGCGT
GCTGAATATCAGCAAGAAAGAGTTGGGCAAGGTACTCAAACGCTACAAGGGTACCGCGTGGGATCAGAGC
CCCATCTTCAAGAAAGTCTACGAACAGGAATATGGCCAGCTTGGCGGCGAGCCGTATGGGTGCCTGGTCG
GCGATTATTACTTCGACCAGAGTCCGCCGGATGTGGAACTGCTCAACGGTATTGCGCAGGTGGCCGCTGC
CGCGCACGCACCGTTCATTGCCGCCGCCGCGCCCAAATTGATGGGCATGGACAACTGGAGCGAGCTCTCC
AATCCGCGCGATCTGGCCAAGATTTTTTCCACGCCCGATTACGCTGCATGGCGCTCGCTGCGCGAATCCG
AAGACTCCAAGTACATCGGTCTGGCCATGCCGCGCACGCTCTCGCGTCTACCTTACGGCGCGGCCACCAG
CCCGGTGGAAGACTTCGATTTCGAGGAAGACACCGCCGGCGCGGATTCCAACAAGTACACCTGGCAGAAT
GCCGCCTATGCGATGGCGGTGAACATCAACCGCTCGTTCAAGCAGTACGGCTGGTGCTCGCGCATTCGCG
GTATCGAGTCCGGCGGCGCAGTGGAAGGGTTGCCCACGCATACCTTTCCCACCGACGACGGTGGCGTGGA
CATGAAGTGCCCGACCGAAGTGGCGATCACCGACCGTCGCTCCGCCGAACTGGACAAGATGGGCCTCATG
CCGCTGGTACATCGCAAGAACTCGGACATGGCCGCCTTCATCAGCGCGCAGTCGCTCAACAAGCCCGACG
AATACGACGACCCGGATGCCACCGCCAACGCAGCATTAGGCGCGCGCCTGCCCTACATGTTTGCGTGCTG
CCGCTTTGCGCACTACCTCAAGTGCATCGTGCGCGACAAGATCGGTTCGTTCTCCGATCGCGAGCAGATG
CAGAGCTGGCTGACACGCTGGGTGACGCAATACATCGACGGCGACCCGTCCAACTCCAGCGAAGAAACCA
AGGCGCGCAAGCCGCTGGCTGCCGCCGAAGTGGTGGTGGAAGAAGTGGAAGGCGCGCCTGGCTACTACAG
CTCCAAGTTCTTCCTCAAGCCGCATTACCAGCTGGAGGGCCTGACCGTGTCGTTGCGGTTGGTCTCGCGG
TTGCCCTCGGCCGCCAAGGCCTGA