SecReT6
Protein ID: 471265714
SecReT6 ID742
T6SS typei3
Gene symbolhcp
Locus tagXCAW_00154
StrainXanthomonas citri subsp. citri Aw12879
Repliconchromosome [GenBank: NC_020815] [Browse all T6SS(s) in this replicon]
Location [Strand]193168..193671 [+]
ProductHemolysin-coregulated protein (uncharacterized)
NoteTssD
UniProt IDM4WB23
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.10E-33, Aligned region: 12..139
Protein Sequence: 167 a.a.     [Download]
>gi|471265714|ref|YP_007648179.1| Hemolysin-coregulated protein (uncharacterized) [Xanthomonas citri subsp. citri Aw12879]
MAFDMHIKFGSGKVKIEGASNHKKHKGEIPILAWSWGASNSGDLHTGGGSASGGKAHVQDISVTKYVDGC
SNALLDAVCTGARVENAWLYVTNATGEQSDFLTLELSEGVLITSLSTGGSGGEDRLTENVTLHFGKFKYG
FQPQDDKGASQGGAKEFTYDIQGVAKA
 
Nucleotide Sequence: 504 bp     [Download]
>gi|471265562|ref|NC_020815.1|:193168-193671 Xanthomonas citri subsp. citri Aw12879, complete genome
ATGGCGTTCGACATGCATATCAAGTTCGGCAGTGGCAAGGTCAAGATCGAAGGCGCATCCAACCACAAGA
AGCACAAGGGCGAGATCCCGATCCTGGCCTGGTCGTGGGGCGCGAGTAATTCCGGCGACCTGCACACCGG
TGGCGGCTCGGCCAGCGGTGGCAAGGCGCATGTCCAGGACATCTCCGTCACCAAGTACGTGGATGGCTGC
TCCAATGCATTGCTCGATGCGGTGTGCACCGGTGCGCGCGTGGAAAACGCCTGGCTGTACGTCACCAACG
CCACCGGCGAGCAGAGCGACTTTCTCACCCTGGAGTTGAGCGAAGGCGTACTGATTACCTCGCTGTCGAC
CGGCGGTTCCGGTGGCGAAGACCGCCTCACCGAAAACGTGACGCTGCACTTCGGCAAGTTCAAGTACGGC
TTCCAGCCGCAGGACGACAAGGGTGCCTCCCAGGGTGGCGCGAAGGAATTCACCTACGACATCCAAGGTG
TGGCCAAGGCCTAA