SecReT6
Protein ID: 471265715
SecReT6 ID742
T6SS typei3
Gene symbol-
Locus tagXCAW_00155
StrainXanthomonas citri subsp. citri Aw12879
Repliconchromosome [GenBank: NC_020815] [Browse all T6SS(s) in this replicon]
Location [Strand]193870..194664 [+]
ProductType VI secretion protein, ImpE/SciE family
NoteTagJ
UniProt IDM4VVF1
KEGG IDxci:XCAW_00155
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 3.90E-42, Aligned region: 139..261
TPR_16 [PF13432], Evalue: 1.90E-05, Aligned region: 5..59
TPR_16 [PF13432], Evalue: 1.90E-05, Aligned region: 107..149
Protein Sequence: 264 a.a.     [Download]
>gi|471265715|ref|YP_007648180.1| Type VI secretion protein, ImpE/SciE family [Xanthomonas citri subsp. citri Aw12879]
MDATAQTLLAQGEPAQALQQLIQQVRRQPADAAQRVFLFQLLAVLGQWSRAADQLRACGELDATTQPLVH
TYLAVLQGEQTRAEVFAGKRLPRVMGEPAEWLAMHLQALQLAAQGHGEQAAALRAQAFERAPASAGVLNG
ERFQWLADADTRFGPCIELILDSGYAWAPLSQIQQLRMQAPLDLRDTVWAPVSVLWRNGGQAFGYLPVRY
PGSEHLDAGELQLARRTEWTLVAQGEIGMGQRMWSTESREIALLDVRDVQFDAG
 
Nucleotide Sequence: 795 bp     [Download]
>gi|471265562|ref|NC_020815.1|:193870-194664 Xanthomonas citri subsp. citri Aw12879, complete genome
ATGGATGCCACCGCACAGACCCTGCTTGCCCAAGGCGAGCCGGCGCAGGCGTTGCAGCAACTGATCCAGC
AGGTGCGCCGGCAACCGGCCGATGCAGCGCAGCGCGTGTTTCTGTTTCAGTTGCTGGCCGTCCTCGGCCA
GTGGTCGCGCGCCGCAGATCAGCTGCGTGCTTGCGGTGAACTGGATGCCACCACGCAGCCCTTGGTCCAC
ACCTATCTGGCGGTATTGCAGGGCGAGCAGACGCGCGCCGAGGTGTTTGCCGGTAAGCGGTTACCGCGCG
TGATGGGTGAGCCGGCCGAGTGGCTGGCAATGCATCTGCAGGCGCTGCAACTGGCGGCGCAAGGGCATGG
CGAACAAGCAGCGGCGTTGCGGGCGCAGGCCTTCGAACGGGCACCAGCCAGTGCCGGCGTGCTCAATGGC
GAACGCTTCCAATGGCTCGCAGATGCCGACACCCGTTTCGGGCCCTGTATCGAGCTCATTCTCGATAGCG
GCTATGCATGGGCCCCGCTCAGCCAGATCCAGCAGCTGCGCATGCAGGCGCCGCTGGATCTGCGCGACAC
CGTGTGGGCGCCGGTGAGCGTGCTGTGGCGCAACGGCGGCCAGGCCTTCGGCTACTTGCCGGTACGTTAC
CCCGGCAGCGAGCACCTGGATGCCGGCGAGCTGCAACTGGCGCGCCGCACCGAATGGACCCTTGTCGCAC
AAGGCGAGATCGGCATGGGCCAGCGCATGTGGAGCACCGAGTCGCGCGAGATTGCGCTGCTGGATGTGCG
CGATGTGCAGTTCGACGCGGGCTGA