SecReT6
Protein ID: 471265716
SecReT6 ID742
T6SS typei3
Gene symbol-
Locus tagXCAW_00156
StrainXanthomonas citri subsp. citri Aw12879
Repliconchromosome [GenBank: NC_020815] [Browse all T6SS(s) in this replicon]
Location [Strand]194670..195173 [+]
ProductHypothetical Protein
NoteTssE
UniProt IDM4VWW4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 5.00E-22, Aligned region: 36..144
Protein Sequence: 167 a.a.     [Download]
>gi|471265716|ref|YP_007648181.1| Hypothetical Protein XCAW_00156 [Xanthomonas citri subsp. citri Aw12879]
MAELTTTERLQPSLLDRLTDAAPSQREESREQRVISATRLRECVIRDLSWLLNAVNLETSRPLEAHPQVR
SSVLNYGIPDLAGVAVSGIDAAALQQRIRQAILAFEPRLIPETLRVSVHADAARMDRRSLLFTIESEMWA
QPLPLNLYLKTALDLETGRLDVVEGNG
 
Nucleotide Sequence: 504 bp     [Download]
>gi|471265562|ref|NC_020815.1|:194670-195173 Xanthomonas citri subsp. citri Aw12879, complete genome
ATGGCCGAACTCACCACCACCGAACGCTTGCAGCCTTCGCTGCTGGACCGGCTCACCGATGCAGCGCCCA
GTCAGCGCGAAGAGAGCCGCGAGCAACGCGTGATTTCGGCCACGCGCCTGCGTGAGTGCGTCATTCGCGA
TCTGTCGTGGTTGCTCAATGCCGTGAACCTGGAAACCAGCCGCCCGCTGGAAGCGCATCCGCAGGTGCGC
AGCTCGGTACTGAATTACGGCATCCCTGATCTGGCCGGCGTCGCAGTGAGCGGCATCGATGCGGCCGCGC
TGCAACAGCGCATTCGCCAGGCGATTCTGGCCTTCGAGCCGCGGCTGATTCCCGAGACGCTGCGGGTGAG
CGTGCATGCCGATGCCGCACGCATGGACCGGCGCTCGCTGTTGTTCACCATCGAATCGGAGATGTGGGCG
CAGCCGCTGCCACTGAACCTGTATCTGAAGACTGCGCTGGATCTGGAAACAGGCCGGCTCGATGTCGTCG
AAGGGAACGGCTGA