SecReT6
Protein ID: 471265717
SecReT6 ID742
T6SS typei3
Gene symbol-
Locus tagXCAW_00157
StrainXanthomonas citri subsp. citri Aw12879
Repliconchromosome [GenBank: NC_020815] [Browse all T6SS(s) in this replicon]
Location [Strand]195178..197061 [+]
ProductType VI secretion protein, VC_A0110 family
NoteTssF
UniProt IDM4VT37
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.10E-221, Aligned region: 5..625
Protein Sequence: 627 a.a.     [Download]
>gi|471265717|ref|YP_007648182.1| Type VI secretion protein, VC_A0110 family [Xanthomonas citri subsp. citri Aw12879]
MDPRLLPYYTRELQHVRDMGAEFAREYPKIAGRLGLDAFECADPYVERLLEGFAFLAARVQLKLDAQYPV
FTQHLLEMVYPHYLAPLPSMAVVQLQPDLKDSGLAAGVVVSRQSALRSLVGPGERTACEFRTAHPVTLWP
LQLAEAKYLESPAALAAAGIALPPGRVVRAGVRLRFELVGGAQTHALALDRLPLFLAGADGLPKRLYEQL
HADTTAVVVRGSDARGGTLEVTLDADAVQMRGFADDDALIPYDGRSFSGYRLLQEYFACPERFLFAELAG
LRAPLRRLHGSSFEVVVLLQRSLPSLAAAVDAEHFKLFCTPAINLFPRRADRIHLQAGLHEYHVLADRTR
PMDFEIHHLGEVEGFGDRQEPEQCFTAFYGGDARTWHARHGAFYSMRREPRMLSARQRRDGARSSYVGSE
VFVSLVDADDQAHSTRLRQLGLQLWCSNRDLPLHMPVGKGASDFTMDSGVPVRSVRCVAGPTKPRPALSD
GQTAWRLLSQLQLNYLSLFEDGPDGAAALREILALYCDPFDASAQRQIEGVKQVSGTPIVRRIPVPGPIT
FGRGLEITLTCEDAAFEGTGAFLLASVLRHFFARYVSVNSFTETVLRTTERNEVARWPAQPGTRPRL
 
Nucleotide Sequence: 1884 bp     [Download]
>gi|471265562|ref|NC_020815.1|:195178-197061 Xanthomonas citri subsp. citri Aw12879, complete genome
ATGGACCCGCGCCTACTGCCGTACTACACCCGCGAGTTGCAGCACGTGCGCGACATGGGCGCGGAGTTTG
CGCGCGAGTATCCCAAGATCGCCGGCCGGCTTGGCCTGGACGCGTTCGAATGCGCCGACCCCTATGTCGA
GCGGCTGCTGGAAGGCTTCGCGTTTCTGGCCGCGCGCGTGCAACTCAAGCTGGACGCGCAGTACCCGGTG
TTCACCCAGCACCTGCTGGAGATGGTCTACCCGCATTATCTGGCGCCGCTGCCGTCGATGGCGGTGGTGC
AGTTGCAGCCGGATCTGAAAGACAGCGGGCTGGCAGCAGGCGTCGTCGTGTCGCGGCAAAGCGCGCTGCG
CAGCCTGGTCGGCCCCGGCGAGCGCACCGCCTGCGAATTCCGCACCGCGCATCCGGTGACCTTGTGGCCG
TTGCAACTGGCCGAGGCCAAGTATCTGGAATCGCCAGCCGCCTTGGCCGCTGCCGGCATCGCTTTGCCGC
CCGGGCGCGTGGTGCGTGCCGGCGTGCGGCTGCGCTTCGAGCTGGTGGGTGGTGCGCAGACGCACGCGCT
GGCGCTGGATCGGCTGCCGCTGTTTCTGGCCGGCGCCGACGGCCTGCCCAAGCGGTTGTACGAACAACTG
CATGCCGATACCACCGCCGTGGTGGTGCGTGGCAGCGATGCCCGCGGTGGCACGCTGGAGGTGACGCTGG
ACGCCGATGCCGTGCAGATGCGCGGCTTTGCCGACGACGATGCATTGATTCCGTACGACGGCCGTTCGTT
CAGTGGCTATCGCCTGCTGCAGGAGTATTTCGCCTGCCCGGAGCGCTTTTTGTTCGCAGAGCTCGCCGGG
CTGCGCGCGCCATTGCGGCGGTTGCACGGCAGCAGCTTCGAGGTGGTGGTGTTGCTGCAACGCAGCCTGC
CCAGCCTGGCTGCGGCAGTAGACGCCGAGCACTTCAAATTGTTCTGCACCCCGGCGATCAATCTGTTCCC
GCGCCGCGCCGATCGCATCCATCTGCAGGCCGGGTTGCACGAGTACCACGTGCTGGCCGACCGCACCCGG
CCGATGGATTTCGAGATCCATCACCTGGGCGAGGTCGAAGGCTTCGGCGATCGTCAGGAGCCCGAGCAAT
GCTTCACCGCGTTCTATGGTGGCGACGCACGCACCTGGCATGCACGGCATGGCGCGTTCTACAGCATGCG
CCGTGAACCGCGCATGCTATCGGCACGTCAGCGCCGCGATGGCGCGCGGTCGAGCTATGTGGGCAGCGAA
GTCTTCGTCAGCCTGGTCGATGCCGACGATCAGGCCCACAGCACGCGCCTGCGTCAGCTTGGGCTGCAAC
TGTGGTGCAGCAACCGCGATCTGCCGCTGCATATGCCGGTAGGCAAGGGCGCAAGCGACTTCACCATGGA
CAGCGGCGTGCCGGTACGGAGCGTGCGCTGCGTGGCCGGGCCGACCAAGCCGCGCCCGGCATTGTCGGAT
GGGCAGACTGCGTGGCGCCTGCTCAGTCAATTGCAGCTCAATTATCTGTCGCTGTTCGAAGATGGCCCCG
ACGGCGCCGCTGCGCTACGCGAGATCCTCGCCCTGTATTGCGACCCGTTCGACGCGTCCGCGCAGCGGCA
GATCGAAGGCGTCAAGCAGGTGAGCGGCACACCGATCGTGCGGCGCATTCCGGTGCCGGGTCCGATCACC
TTCGGCCGCGGCCTGGAGATCACGCTGACCTGCGAGGACGCCGCCTTCGAAGGCACTGGCGCCTTCCTGC
TGGCTTCGGTGCTGCGGCACTTCTTCGCGCGCTATGTCTCGGTGAATTCCTTTACCGAAACCGTGCTGCG
TACCACCGAACGCAACGAGGTGGCCCGGTGGCCAGCCCAGCCCGGCACGCGCCCGCGCCTGTGA