SecReT6
Protein ID: 471265718
SecReT6 ID742
T6SS typei3
Gene symbol-
Locus tagXCAW_00158
StrainXanthomonas citri subsp. citri Aw12879
Repliconchromosome [GenBank: NC_020815] [Browse all T6SS(s) in this replicon]
Location [Strand]197058..198065 [+]
ProductType VI secretion protein, VC_A0111 family
NoteTssG
UniProt IDM4VTK1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.60E-105, Aligned region: 14..318
Protein Sequence: 335 a.a.     [Download]
>gi|471265718|ref|YP_007648183.1| Type VI secretion protein, VC_A0111 family [Xanthomonas citri subsp. citri Aw12879]
MSAAAAALAQALQTRPQDFSPFAALRAIERCHPQQPRLGESARASDDVLRLRHAPSLAFAPHALHRYTPA
THDQPAALYGVFFGLFGPNAPLPLHLTEYAIERAQQAKDGTFAAFADVFHHRMLSLFYRAWAQAQPSVQA
ERPASDQFRAWLDALVGIASPHLRQRDALPDDARRYYAGRLGTATRTPEGLRALLQQLFEWPVQVQEFIA
EWMRLPADAHLQLGLGPRNARLGVDSVVGAHVRGAQQRVRIRLGPLPRLAFQRFLPGGQALKQLTATVRS
YLGDEFGWELQLSLKADEVPTPHLARNSRLGLDTWLGRRAWSIADADDVVLHPSG
 
Nucleotide Sequence: 1008 bp     [Download]
>gi|471265562|ref|NC_020815.1|:197058-198065 Xanthomonas citri subsp. citri Aw12879, complete genome
GTGAGCGCCGCGGCTGCCGCGCTGGCACAGGCGCTGCAGACCCGGCCACAGGATTTCAGCCCATTCGCGG
CCTTGCGCGCGATCGAACGCTGCCATCCGCAGCAGCCGCGCCTGGGCGAATCGGCGCGCGCCAGCGACGA
TGTGCTGCGGCTGCGGCATGCGCCGTCACTGGCATTCGCACCCCATGCGCTGCACCGCTACACACCGGCA
ACGCACGATCAGCCTGCCGCGCTGTATGGCGTGTTTTTCGGTCTTTTCGGGCCAAACGCGCCGTTGCCGT
TGCACCTGACCGAATACGCCATCGAGCGTGCGCAGCAAGCCAAGGACGGCACCTTCGCCGCGTTTGCCGA
TGTGTTCCACCACCGCATGCTGAGCCTGTTCTACCGCGCCTGGGCGCAGGCACAGCCCAGCGTGCAGGCC
GAGCGCCCGGCGAGCGACCAGTTCCGTGCGTGGCTGGATGCATTGGTGGGCATCGCCAGCCCGCACCTGC
GCCAACGCGATGCATTGCCGGACGATGCACGTCGTTACTACGCCGGCCGTCTTGGCACCGCCACACGCAC
GCCGGAAGGCTTGCGTGCCCTGCTGCAACAGTTGTTCGAATGGCCGGTGCAGGTACAGGAATTCATCGCC
GAATGGATGCGCCTGCCGGCCGATGCGCACCTGCAACTTGGTTTGGGTCCGCGCAACGCGCGGCTGGGCG
TGGACAGCGTGGTGGGCGCACACGTGCGTGGCGCCCAGCAACGCGTGCGCATCCGCCTGGGGCCGCTGCC
GCGCCTGGCGTTTCAACGCTTTCTGCCGGGTGGCCAGGCGCTGAAGCAACTCACCGCCACGGTGCGCAGC
TATCTGGGCGACGAATTCGGCTGGGAACTGCAGCTGTCGCTCAAGGCCGACGAGGTCCCTACGCCGCACC
TGGCGCGCAATAGCCGGCTGGGCCTGGACACCTGGCTGGGCCGCCGCGCCTGGAGCATTGCCGATGCCGA
CGACGTGGTGCTGCACCCCTCCGGGTGA