SecReT6
Protein ID: 471265735
SecReT6 ID742
T6SS typei3
Gene symbolvgrG
Locus tagXCAW_00175
StrainXanthomonas citri subsp. citri Aw12879
Repliconchromosome [GenBank: NC_020815] [Browse all T6SS(s) in this replicon]
Location [Strand]220257..222224 [+]
ProductHypothetical Protein
NoteTssI
UniProt IDM4VVI7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.50E-70, Aligned region: 24..329
Phage_base_V [PF04717], Evalue: 1.90E-24, Aligned region: 50..64
Phage_base_V [PF04717], Evalue: 1.90E-24, Aligned region: 367..459
Protein Sequence: 655 a.a.     [Download]
>gi|471265735|ref|YP_007648200.1| Hypothetical Protein XCAW_00175 [Xanthomonas citri subsp. citri Aw12879]
MPRTIMLHSDLGERLLLHRMQASEALGQLFDYRIDALCTELQTNLRDLLGTPVAVQLADGEGEQRWYHGM
VASCAHNGYAVVDALEYAVLELQVVPKPWLLTQRRDCRIYQDMSVPEIVTSVLGEIGYGDVQQQLSAQYA
KRTYCVQYREDDFSFISRLLEREGIYYYFTHSRSAHTLVLADALGAHAAQNGVDSLPYAPPGTDDRRLMR
SVVSHWRSARGVHSSQHGSTDYDPLQPRASLAAEADASGEQLHTVDGLIAFDYPGAHTVQTDGNRYMQVR
SEAHNVQRASHAATTNACGLMVGALFRLRGFPRAELNQEYLVLSAHTTLAAPEHASGEPPFSSSVQVMES
RLPFRSLQRTVTPTIAGLQTAVVTGDTDEDIAVDAHGRVQVTFHWATAARPHAALSCWVRVASMWAGKGW
GAMSLPRVGQEVVVSFLEGDPDRPLIVGSVYNGDHAPPFSLPDNKTQSGVRSRSLLGGTADFNELRFEDK
AGAEELYLRAQRDLREEVQHDHTSTIDNDRVLTVKHDRSARIDNNDSVDVGKKLLLKAGEEIELVTGSAR
LVMKQNGEIVLSGIKILVDASSEAKITSTAIKLLADAQLQAKSPATEVAGDATLKLTSGGMLSAEAGASA
TLKGPLVSIKADALVQVGGGLIMIG
 
Nucleotide Sequence: 1968 bp     [Download]
>gi|471265562|ref|NC_020815.1|:220257-222224 Xanthomonas citri subsp. citri Aw12879, complete genome
ATGCCGCGCACCATCATGCTGCACTCCGACCTTGGCGAGCGCCTGCTGCTGCACCGCATGCAGGCCAGCG
AAGCGTTGGGGCAGCTGTTCGACTACCGCATCGATGCGTTGTGCACCGAGCTGCAGACCAACCTGCGTGA
TCTGCTTGGCACGCCAGTGGCGGTGCAACTGGCCGATGGCGAGGGCGAACAGCGCTGGTATCACGGCATG
GTGGCCAGTTGCGCGCACAACGGCTACGCCGTGGTCGATGCGCTCGAGTACGCCGTGCTGGAACTGCAGG
TGGTGCCCAAACCATGGCTGCTGACACAGCGCCGCGATTGCCGTATCTATCAGGACATGAGCGTGCCGGA
GATCGTCACCAGCGTGCTGGGCGAGATCGGCTACGGCGATGTGCAGCAGCAGTTGAGCGCGCAGTACGCC
AAGCGCACCTACTGCGTGCAATACCGCGAGGACGATTTCAGCTTCATCAGCCGGCTGCTGGAACGCGAAG
GCATCTACTACTACTTCACCCATAGCCGCAGTGCGCATACCTTGGTGCTGGCCGATGCGCTGGGTGCGCA
TGCAGCGCAAAATGGCGTGGACAGCTTGCCGTATGCGCCGCCGGGCACCGACGACCGGCGCCTGATGCGC
TCGGTGGTGAGCCATTGGCGCAGTGCGCGCGGCGTACATTCCAGCCAGCATGGCAGCACCGACTACGACC
CGCTGCAGCCGCGTGCATCGCTGGCCGCCGAGGCCGACGCCAGCGGCGAACAGTTGCACACCGTCGATGG
TCTGATCGCCTTCGACTATCCCGGTGCGCATACAGTGCAAACCGACGGTAATCGCTACATGCAGGTGCGC
AGCGAGGCGCACAACGTGCAGCGCGCCAGCCATGCAGCCACCACCAATGCCTGCGGCCTGATGGTCGGTG
CCTTGTTTCGCTTGCGCGGGTTTCCGCGTGCCGAACTCAATCAGGAATATCTGGTGCTGTCGGCGCACAC
CACGCTGGCCGCGCCCGAACACGCTAGCGGCGAGCCGCCGTTTTCCAGCAGCGTGCAGGTGATGGAAAGC
CGGCTGCCGTTCCGTAGCCTGCAACGCACCGTAACGCCGACCATTGCCGGCCTGCAGACGGCGGTGGTGA
CCGGCGACACCGACGAGGACATTGCGGTGGATGCGCATGGCCGCGTGCAGGTGACCTTTCACTGGGCCAC
TGCGGCACGCCCGCATGCCGCACTGTCGTGCTGGGTGCGTGTGGCCTCGATGTGGGCGGGCAAGGGCTGG
GGCGCGATGAGCCTGCCACGCGTGGGGCAGGAAGTGGTGGTGAGCTTTCTGGAAGGCGACCCGGACCGCC
CGCTGATCGTGGGCAGCGTCTACAACGGCGACCATGCGCCGCCGTTTTCCTTGCCCGACAACAAGACCCA
AAGCGGCGTGCGCAGCCGCAGCCTGCTGGGCGGCACTGCCGATTTCAACGAGCTGCGATTCGAAGACAAG
GCCGGCGCAGAAGAGCTCTACCTGCGTGCGCAACGCGATCTGCGCGAAGAAGTGCAGCACGATCACACCA
GCACCATCGACAACGATCGGGTGCTGACCGTCAAGCACGACCGCAGCGCGCGTATCGACAATAACGACAG
CGTGGATGTCGGCAAGAAGCTGCTGCTGAAAGCCGGCGAAGAGATCGAGTTGGTGACCGGCAGCGCGCGC
CTGGTGATGAAGCAGAACGGCGAGATCGTGTTGAGCGGCATCAAGATCCTGGTCGATGCCAGCTCGGAAG
CCAAGATCACCTCCACCGCCATCAAGCTCCTTGCCGATGCACAGCTGCAGGCCAAATCGCCGGCCACCGA
AGTGGCTGGCGATGCCACGCTTAAACTGACCTCCGGCGGCATGCTCAGTGCCGAAGCCGGTGCCTCGGCC
ACGCTCAAGGGTCCTTTGGTCAGCATCAAGGCCGACGCCTTGGTGCAGGTCGGCGGCGGCCTGATCATGA
TCGGATGA