SecReT6
Protein ID: 471265737
SecReT6 ID742
T6SS typei3
Gene symbol-
Locus tagXCAW_00177
StrainXanthomonas citri subsp. citri Aw12879
Repliconchromosome [GenBank: NC_020815] [Browse all T6SS(s) in this replicon]
Location [Strand]223056..224372 [+]
ProductFHA-domain-containing protein
NoteFha
UniProt IDM4VT81
KEGG IDxci:XCAW_00177
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.20E-15, Aligned region: 32..95
Protein Sequence: 438 a.a.     [Download]
>gi|471265737|ref|YP_007648202.1| FHA-domain-containing protein [Xanthomonas citri subsp. citri Aw12879]
MSSSQLILTVGGAQAAQFGASAQKRFAGTGGSIGRSDESDWVLAAPGVSRTHAVVRFLNGMYFIEDRSTN
GMSLNGTALTRADPSALSDGDRLQLDSFEIHVQVQSLAAAPTPAPAFDPLPDAMDDRTQVAPPPSTRRAP
SATACLDLLEFGTPPSARPAVDALLDDLLLSGAPGELDPLRLLDPSPAPARDASPSAWNQSNASHDHFRP
PASPDARATLPENWDMTLGDFAPPAPLPALAPMAAPVASPFAPPAAVSVATAPSAATTVPPELDRIFAIV
VDGVMDVLRARAEIKNTFRLPVTVIQRSENNPLKFAATAEDALQKLLAPPSASFLSGVPAFEDAFDDIRC
HQMAMLAGMRAAFDAMLFHFSPDRLEQEADAGGKRLGFGGKGRYWERYRDNFEQLRSDPDDCFRRLFGDE
FARAYEAQLARLKSARRH
 
Nucleotide Sequence: 1317 bp     [Download]
>gi|471265562|ref|NC_020815.1|:223056-224372 Xanthomonas citri subsp. citri Aw12879, complete genome
GTGTCCAGTTCGCAGTTGATCCTCACCGTCGGCGGCGCGCAGGCCGCGCAGTTCGGCGCCAGCGCGCAGA
AGCGCTTTGCCGGCACCGGCGGCAGCATCGGCCGCTCCGACGAAAGCGATTGGGTCCTGGCCGCGCCCGG
TGTCTCGCGCACGCATGCGGTGGTGCGCTTTCTCAACGGGATGTATTTCATCGAGGACCGCAGCACCAAC
GGCATGTCGCTCAACGGCACTGCGCTGACGCGTGCGGACCCGTCCGCGCTCAGCGATGGCGACCGCCTGC
AGCTGGACAGCTTCGAGATCCATGTGCAGGTGCAATCGCTGGCTGCAGCCCCGACGCCGGCGCCGGCATT
CGACCCGCTGCCAGATGCGATGGACGACCGCACCCAGGTTGCGCCGCCGCCGTCGACGCGGCGTGCCCCC
TCCGCCACAGCGTGCCTGGATCTGCTGGAGTTCGGTACGCCGCCTTCTGCGCGGCCTGCAGTGGACGCGT
TGTTGGACGATCTGCTGCTGAGCGGCGCACCCGGCGAGCTGGATCCGTTGCGCCTGCTCGACCCGTCGCC
TGCACCGGCACGCGATGCCAGCCCCAGCGCGTGGAATCAGAGCAACGCCAGCCACGACCATTTCCGTCCA
CCGGCCAGTCCCGATGCGCGCGCCACCTTGCCGGAAAACTGGGACATGACGCTTGGCGATTTTGCGCCGC
CCGCGCCATTGCCTGCGTTAGCGCCCATGGCCGCGCCGGTGGCCTCGCCATTCGCGCCGCCGGCGGCGGT
GTCGGTTGCAACCGCACCATCGGCGGCAACAACAGTGCCGCCGGAGCTGGATCGCATCTTCGCCATCGTG
GTCGATGGCGTCATGGATGTGCTGCGTGCACGCGCAGAGATCAAGAACACCTTTCGCTTGCCGGTCACGG
TGATCCAACGCTCGGAGAACAACCCGCTCAAGTTCGCCGCCACCGCCGAAGATGCGCTGCAGAAGTTGCT
CGCACCGCCAAGCGCGTCGTTTCTGTCCGGGGTGCCAGCGTTCGAAGATGCCTTCGACGATATCCGCTGC
CATCAGATGGCGATGCTGGCCGGCATGCGCGCGGCCTTCGACGCCATGCTGTTCCACTTCAGCCCGGACC
GCCTGGAGCAGGAAGCCGACGCCGGCGGTAAGCGCCTGGGTTTCGGTGGCAAGGGGCGTTACTGGGAACG
CTACCGCGACAATTTCGAGCAGCTGCGCAGCGACCCGGACGACTGCTTCCGTCGCCTGTTCGGCGATGAG
TTCGCGCGTGCCTACGAGGCGCAACTGGCGCGCTTGAAATCGGCACGGCGGCATTGA