SecReT6
Protein ID: 471265738
SecReT6 ID742
T6SS typei3
Gene symbol-
Locus tagXCAW_00178
StrainXanthomonas citri subsp. citri Aw12879
Repliconchromosome [GenBank: NC_020815] [Browse all T6SS(s) in this replicon]
Location [Strand]224952..226286 [+]
ProductType VI secretion protein, VC_A0114 family
NoteTssK
UniProt IDM4VTP3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.10E-153, Aligned region: 18..443
Protein Sequence: 444 a.a.     [Download]
>gi|471265738|ref|YP_007648203.1| Type VI secretion protein, VC_A0114 family [Xanthomonas citri subsp. citri Aw12879]
MQNNKVVWSEGLFLRPQHLQQQERYLERYVDLRAARLRPHAWGVSELEWESDLLAVGKLGLRRARGVFAD
GTPFAMPGDDPLPVALEVEPNCRDQIVYLTVPLRVPAQPELGRPESPADQLFRYRVRETESNDASGSTSE
AVLMEVGGLSTRLLPHSQPLEGLDRIAVARIIEMRADRQVVLDPHFIPSAMVCQAAPRLTTFLTELLGLL
HQRGEALASRVTLTDRGGAADIADFLLLQLVNRWQPQMAHWAAAPLAHPEELFRALVALAGELSTFTAAG
KRPPAWPAYRHQSQQDSFEPVIGALRSSLSAVLEQTATPLPIQARKFGVWVAMVPDPGLLDSAAFVLAAK
ADMPSEELRRQLPAHAKIGPVEQIRDLVNLQLPGIVATPMPVAPRQIPYHAGYLYFEFDKSAALWRTLKT
SGGIAFHFGSEFAGLDLQLWAIRS
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|471265562|ref|NC_020815.1|:224952-226286 Xanthomonas citri subsp. citri Aw12879, complete genome
ATGCAGAACAACAAGGTCGTGTGGAGCGAAGGGCTGTTCCTGCGCCCGCAGCATCTGCAGCAGCAAGAGC
GCTACCTGGAGCGCTACGTCGATCTGCGTGCCGCGCGATTGCGGCCGCATGCCTGGGGCGTGAGCGAGCT
GGAATGGGAGAGCGACCTGCTGGCGGTGGGCAAGCTGGGCCTGCGGCGCGCGCGTGGCGTGTTCGCCGAT
GGCACGCCCTTCGCGATGCCGGGCGACGACCCGCTGCCGGTTGCGCTGGAGGTCGAGCCCAACTGCCGCG
ACCAGATCGTCTATCTCACCGTACCGCTGCGGGTGCCGGCGCAGCCCGAACTCGGGCGCCCGGAATCGCC
GGCCGATCAGCTGTTTCGCTACCGCGTGCGCGAGACCGAAAGCAACGACGCCTCCGGCAGCACCAGCGAA
GCGGTGTTGATGGAAGTCGGCGGGTTGAGCACGCGGTTGCTGCCGCACTCGCAACCGTTGGAGGGGCTGG
ACCGCATCGCGGTGGCGCGCATCATCGAGATGCGCGCCGACCGTCAGGTGGTGCTGGACCCGCATTTCAT
TCCCAGCGCGATGGTATGCCAGGCGGCGCCGCGCTTGACCACCTTTCTGACCGAGTTGCTCGGTCTGTTG
CATCAGCGCGGCGAAGCGCTGGCATCGCGCGTGACGCTGACCGATCGCGGCGGTGCGGCCGATATCGCAG
ACTTTCTGCTGCTGCAGCTGGTCAACCGTTGGCAGCCGCAGATGGCGCACTGGGCGGCCGCGCCATTGGC
GCATCCGGAAGAGTTGTTTCGCGCCTTGGTGGCGCTGGCCGGTGAACTGAGCACGTTCACCGCTGCCGGC
AAGCGCCCGCCTGCATGGCCTGCCTATCGGCACCAATCGCAGCAGGACAGCTTCGAGCCGGTGATCGGCG
CCTTGCGCAGCAGTTTGAGCGCAGTGCTCGAACAGACCGCCACGCCGCTCCCGATCCAGGCGCGCAAGTT
CGGCGTGTGGGTGGCGATGGTGCCGGACCCGGGCCTGCTCGACAGCGCGGCGTTCGTGCTCGCGGCCAAG
GCCGACATGCCCAGCGAAGAGTTGCGCCGGCAATTGCCCGCGCACGCCAAGATCGGGCCGGTGGAGCAGA
TTCGCGATCTGGTCAATCTGCAGTTGCCCGGCATCGTGGCCACGCCCATGCCGGTGGCGCCGCGACAGAT
TCCGTATCACGCCGGCTATCTGTATTTCGAATTCGACAAGAGCGCAGCGTTGTGGCGAACGCTGAAGACC
TCCGGCGGTATCGCATTCCACTTCGGCAGCGAATTCGCCGGGTTGGACCTGCAATTGTGGGCGATCCGGA
GCTGA