SecReT6
Protein ID: 471265739
SecReT6 ID742
T6SS typei3
Gene symbol-
Locus tagXCAW_00179
StrainXanthomonas citri subsp. citri Aw12879
Repliconchromosome [GenBank: NC_020815] [Browse all T6SS(s) in this replicon]
Location [Strand]226289..227548 [+]
ProductType VI secretion system OmpA/MotB family protein
NoteTssL
UniProt IDM4WB63
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.30E-69, Aligned region: 40..244
DUF2077 [PF09850], Evalue: 4.30E-69, Aligned region: 368..409
OmpA [PF00691], Evalue: 2.60E-11, Aligned region: 310..399
Protein Sequence: 419 a.a.     [Download]
>gi|471265739|ref|YP_007648204.1| Type VI secretion system OmpA/MotB family protein [Xanthomonas citri subsp. citri Aw12879]
MSRPVADLAPAYAAPLPAAGGTGVPSEDTDISELLGRSVNPLVQAATPLLLLAVQLRHSAQSPDVARLRE
QVMAQVRRFEHRARDGGAPVEAVTAARYVLCALLDEAVLNAPWGERSGWSQKTLLVTFHSESYGGAKFFQ
ILERLCADMPRHLDLIELMYLCLALGFVGRYQIEAGGIATLAAIQEDVYRRIRAARGPAPDSLAPRWRGV
EDRRRLGRYLPVWAAALLGLSLVVVAFVWLQARLNSLSAPISAQAAQWGIAPATPPDAAPVPPPPVRLKQ
LLSAQERAGLLRVDEQADGQTRVRLSSAAMFASGGVEVELQQRGLIAQIAAAIEQLPGRVIVVGHTDDVP
VRSLRFQDNYALSAARAQALAQVLQAQLSTPGRVEAIGAGASQPIAQPVQLPANRARNRRVEILFQPGE
 
Nucleotide Sequence: 1260 bp     [Download]
>gi|471265562|ref|NC_020815.1|:226289-227548 Xanthomonas citri subsp. citri Aw12879, complete genome
ATGAGCCGACCTGTTGCCGATCTGGCGCCAGCCTACGCCGCACCGCTGCCGGCCGCAGGGGGCACCGGCG
TGCCCAGCGAAGACACCGACATCAGCGAATTGCTGGGCCGCAGCGTCAACCCGTTGGTGCAGGCCGCCAC
GCCGCTGCTGCTGTTGGCGGTGCAGTTGCGCCACAGTGCGCAATCGCCCGATGTGGCCCGCCTGCGCGAG
CAGGTGATGGCGCAGGTGCGCCGCTTCGAACACCGTGCGCGCGATGGAGGCGCGCCGGTGGAAGCGGTCA
CCGCCGCGCGCTACGTGTTGTGCGCGCTGCTGGACGAAGCGGTGCTCAACGCACCGTGGGGCGAGCGCAG
CGGCTGGTCGCAGAAGACCTTGCTGGTGACCTTCCACAGCGAATCGTACGGCGGCGCCAAGTTCTTCCAG
ATCCTGGAGCGCTTGTGCGCCGATATGCCGCGGCATCTGGACTTGATCGAGTTGATGTACCTGTGCCTGG
CGCTGGGGTTCGTCGGCCGCTACCAGATCGAGGCCGGCGGCATCGCGACGCTGGCGGCCATCCAGGAGGA
TGTCTATCGCCGCATCCGTGCGGCGCGCGGCCCCGCGCCGGACAGCTTGGCGCCGCGTTGGCGCGGGGTG
GAAGACCGCCGCCGGCTGGGCCGTTATCTGCCGGTGTGGGCGGCTGCATTGCTGGGGTTGAGCCTGGTGG
TGGTGGCGTTCGTGTGGTTGCAGGCGCGTTTGAACAGCCTGTCCGCACCGATCAGTGCGCAGGCCGCCCA
ATGGGGAATTGCGCCGGCCACGCCGCCGGACGCTGCACCCGTGCCGCCGCCTCCGGTGCGGCTCAAGCAG
TTGCTCTCCGCGCAGGAACGCGCCGGCCTGCTGCGCGTGGACGAACAGGCCGACGGGCAGACGCGCGTGC
GCCTCAGCAGCGCGGCGATGTTCGCCTCCGGCGGGGTGGAGGTGGAGCTGCAGCAGCGCGGCTTGATCGC
GCAGATTGCAGCGGCCATCGAGCAATTGCCGGGGCGGGTGATCGTGGTCGGGCACACCGATGACGTGCCG
GTGCGCTCGCTGCGCTTCCAGGACAACTACGCCTTGTCGGCCGCGCGTGCGCAGGCGCTTGCGCAGGTGT
TGCAGGCGCAGCTGAGCACGCCGGGGCGGGTGGAAGCCATTGGCGCCGGCGCTTCGCAACCGATCGCACA
GCCGGTGCAATTACCGGCCAACCGCGCGCGCAACCGCCGCGTGGAGATCTTGTTCCAGCCTGGGGAATGA