SecReT6
Protein ID: 471265747
SecReT6 ID742
T6SS typei3
Gene symbol-
Locus tagXCAW_00187
StrainXanthomonas citri subsp. citri Aw12879
Repliconchromosome [GenBank: NC_020815] [Browse all T6SS(s) in this replicon]
Location [Strand]245392..246435 [+]
ProductType VI secretion-associated protein, ImpA family
NoteTssA
UniProt IDM4VT87
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.70E-21, Aligned region: 56..116
Protein Sequence: 347 a.a.     [Download]
>gi|471265747|ref|YP_007648212.1| Type VI secretion-associated protein, ImpA family [Xanthomonas citri subsp. citri Aw12879]
MQDDSSLETLLAPLGDDAPAGPDLEYDPEFLRLERESAVRAERALGESVIAAEEPDWDKVQALALDLCRR
SRDLRVAGRLGAAWLRLRGLPGWADALALIHGLLERHWDSVHPQLDADDDNDPTSRINALVGLSDPMGLL
GALRATAFVQSPRLGRFSLRDLRVANGSIKLPDGQSGPSLAEIEACCQDCTPETLATSAQAITEALRQAR
AIDALLSERVGTAAPDLRPLLTDLRDLERFVLPHWQARQGISAIAEDGEQAAGEGHAVAMATNATCRNDE
IAGPDDVKRRLEEICAYYARHEPSSPVPMLLRRAQRLVGADFLALMKELAPAGIDELQRVTGPLEDS
 
Nucleotide Sequence: 1044 bp     [Download]
>gi|471265562|ref|NC_020815.1|:245392-246435 Xanthomonas citri subsp. citri Aw12879, complete genome
ATGCAAGACGACAGTTCCCTGGAGACCCTGCTGGCGCCGCTCGGCGACGACGCCCCGGCCGGACCGGATC
TGGAATACGACCCGGAGTTCCTGCGCCTGGAGCGCGAATCGGCGGTCCGCGCCGAGCGCGCGCTGGGCGA
GAGCGTCATCGCCGCCGAAGAACCGGACTGGGACAAGGTACAGGCGCTGGCGCTGGACCTGTGCCGGCGT
AGCCGCGACTTGCGCGTGGCCGGCAGGCTCGGCGCCGCCTGGCTGCGCCTGCGCGGCCTGCCGGGCTGGG
CCGACGCGCTGGCGTTGATCCATGGCCTGCTTGAGCGCCATTGGGACAGCGTGCATCCGCAACTGGATGC
CGACGACGACAACGACCCGACCTCGCGCATCAATGCGCTGGTCGGTCTTAGCGACCCGATGGGCCTGCTC
GGCGCGCTGCGCGCCACCGCGTTCGTGCAGTCGCCGCGGCTGGGCCGCTTCAGCCTGCGCGATCTACGCG
TGGCCAATGGCAGCATCAAGCTGCCCGACGGCCAGAGCGGCCCCAGCCTGGCCGAAATCGAAGCCTGCTG
CCAGGACTGCACGCCGGAAACGCTGGCCACCTCCGCCCAGGCCATTACCGAAGCGCTGCGGCAGGCGCGC
GCGATCGATGCGCTGCTGAGCGAACGTGTCGGCACCGCCGCCCCTGACTTGCGCCCGCTACTGACCGACC
TGCGCGATCTGGAGCGCTTCGTGCTGCCGCACTGGCAAGCGCGGCAGGGCATCTCGGCGATCGCCGAAGA
CGGCGAGCAGGCTGCCGGCGAAGGCCACGCCGTCGCCATGGCAACCAACGCCACGTGCCGCAACGACGAG
ATCGCCGGCCCCGATGATGTGAAGCGGCGGCTGGAAGAGATCTGCGCCTATTACGCCCGGCACGAACCGT
CCAGCCCGGTGCCGATGCTGCTGCGCCGTGCGCAACGCCTGGTCGGCGCCGATTTCCTGGCCCTGATGAA
GGAGCTGGCCCCGGCCGGCATCGACGAACTGCAACGCGTCACCGGCCCGCTGGAAGACAGCTAA