SecReT6
Protein ID: 471316100
SecReT6 ID737
T6SS typei1
Gene symbol-
Locus tagHCBAA847_1594
StrainHelicobacter cinaedi ATCC BAA-847
Repliconchromosome [GenBank: NC_020555] [Browse all T6SS(s) in this replicon]
Location [Strand]1531831..1532733 [-]
Producthypothetical protein
NoteTssG
UniProt IDI7HFN2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.00E-44, Aligned region: 21..285
Protein Sequence: 300 a.a.     [Download]
>gi|471316100|ref|YP_007601455.1| conserved hypothetical protein [Helicobacter cinaedi ATCC BAA-847]
MNNTTYFTFHKLLYKLLKKYDKRDIFLRTNKSLKHPHKEIEYIEENKEFLIEIMVNFMGLQGNTSQLPSY
MLDKLSRNEDGGSGWTLFFDFFNHYILWLFFESANLKNYSRSFKKDFSDSISKILFSILGINDREIAKNY
LPFAPLLLSASRPKYYIEKVLQSNFNLHNKLYIIENLPHQIFIAPSQKNKLGIKNDVLGKNFILGSKFLS
YQSKIGIYIKDIEYHRAIEYLPNQNKHEELKESILFLTNHQFCIDLYLRINHNEKMNFILGDESVAKLSW
GLALGNFKKKYHLMCIKMYE
 
Nucleotide Sequence: 903 bp     [Download]
>gi|471314537|ref|NC_020555.1|:c1532733-1531831 Helicobacter cinaedi ATCC BAA-847 DNA, complete genome
ATGAACAATACGACTTATTTTACTTTCCATAAGCTTCTTTATAAGCTTCTTAAAAAATACGACAAAAGGG
ACATTTTTTTAAGAACCAATAAAAGCCTCAAACACCCTCATAAAGAGATTGAATACATTGAAGAAAATAA
AGAGTTTTTGATTGAAATAATGGTAAATTTTATGGGATTGCAAGGCAATACATCACAACTACCCTCTTAT
ATGCTTGATAAGCTCTCAAGGAATGAAGATGGAGGCTCTGGATGGACATTATTCTTTGATTTTTTTAATC
ATTATATTCTTTGGCTCTTTTTTGAAAGCGCGAATTTGAAAAATTATTCTAGAAGTTTCAAAAAAGATTT
CAGTGATTCTATTTCAAAGATTTTATTTTCTATATTGGGCATTAATGATAGAGAAATTGCTAAAAATTAT
TTGCCTTTTGCACCTTTGCTTTTAAGTGCCTCTCGTCCTAAATATTATATAGAAAAAGTATTGCAAAGTA
ATTTTAATTTGCATAATAAATTATATATCATTGAAAATCTCCCACATCAGATTTTCATCGCTCCTTCTCA
AAAAAATAAATTAGGTATTAAAAATGATGTTTTAGGTAAAAATTTTATTTTAGGGAGTAAATTCCTCTCT
TATCAGAGCAAGATAGGTATTTATATCAAAGACATTGAATACCATAGAGCCATAGAATATTTACCCAATC
AAAATAAACACGAAGAACTCAAAGAGAGCATACTATTTCTTACCAATCATCAATTTTGTATTGACTTGTA
TTTGCGTATTAACCACAATGAAAAAATGAATTTTATTCTAGGTGATGAAAGTGTAGCAAAACTTAGTTGG
GGATTAGCATTGGGGAATTTTAAGAAAAAATATCATTTAATGTGTATTAAAATGTATGAATAA