SecReT6
Protein ID: 471316101
SecReT6 ID737
T6SS typei1
Gene symbol-
Locus tagHCBAA847_1595
StrainHelicobacter cinaedi ATCC BAA-847
Repliconchromosome [GenBank: NC_020555] [Browse all T6SS(s) in this replicon]
Location [Strand]1532730..1534454 [-]
ProductVC_A0110 family type VI secretion protein
NoteTssF
UniProt IDI7H5K3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 7.50E-130, Aligned region: 8..572
Protein Sequence: 574 a.a.     [Download]
>gi|471316101|ref|YP_007601456.1| VC_A0110 family type VI secretion protein [Helicobacter cinaedi ATCC BAA-847]
MNNEDVFYYQKELSYLYQTREYFVKKFPKLAPFLALDSKDPDIERIIENLAILTSKIHQEMEQNIPYIAE
SLLNVVSPNYTNPLPSLCMQEFLLNKDSKKNKIIVPKGSRLQSITIEQIECEFRTIYDVYLYPLDIDEVF
MSSEKQYHTMDLRLKVNKPDLKICDIGLDCLNLYLGDDIYTSATLLLFIHLYLEEVKIISCDTSEKFKLN
SCNITTIGLEPNESCLNYDDLGFEAFSLLREYFFIPEKFNFIRIQGLDILKDCQGSNLSIQFKFNKIFPK
NCIVRADLFSLSITPIVNIFPKNAESIINDHTKDGYRIFVDRVHLDSYEIIKINQVKAHNSDSGRRILKN
YKSFERFEFLKDNQNEFYSINVKKNSKGETYKEISFFSGHSYNEIITIDALCCNKNLPSKLKIGDIRHIN
FEDISTKNIKIPSMMREYSVDGHLLWKLVSILSFNYQSILNTTSFFGVLESYSFVNDKENEETYKRLKNS
IAYIESKSTYLVDEYITKKGTLCIMGIKDSNFYSLGEVYKLGLIISKFFASFVSINSFCELKIKCLDSKE
ILYYPATRGKKVSL
 
Nucleotide Sequence: 1725 bp     [Download]
>gi|471314537|ref|NC_020555.1|:c1534454-1532730 Helicobacter cinaedi ATCC BAA-847 DNA, complete genome
GTGAATAATGAAGATGTATTTTACTACCAAAAAGAGCTTTCCTATCTCTATCAAACAAGAGAATATTTTG
TCAAAAAATTTCCAAAACTCGCACCATTTTTAGCTCTTGATAGTAAAGACCCAGATATTGAGAGAATTAT
TGAAAATCTTGCTATTTTGACTTCTAAAATTCATCAGGAAATGGAACAAAATATTCCATACATAGCAGAA
TCTTTGTTGAATGTAGTCTCTCCTAATTATACTAATCCACTACCTTCTTTGTGTATGCAAGAGTTTCTTT
TAAATAAAGATAGTAAAAAAAATAAGATTATTGTTCCAAAAGGAAGTCGCCTTCAGTCTATAACCATAGA
ACAAATTGAGTGTGAGTTTAGAACGATTTATGATGTTTATCTCTACCCTTTAGATATTGATGAAGTGTTT
ATGAGCAGTGAAAAACAATATCACACAATGGATTTAAGGTTAAAGGTTAATAAGCCTGATTTAAAAATTT
GTGATATAGGATTAGATTGTTTAAATTTATATCTTGGAGATGACATCTACACTTCCGCAACTTTACTTTT
ATTCATTCACCTTTATTTGGAGGAGGTAAAAATCATTTCTTGTGATACTTCTGAAAAGTTTAAGCTTAAT
TCTTGCAACATTACAACAATAGGGCTTGAACCAAATGAAAGTTGTTTAAATTATGATGATTTAGGGTTTG
AGGCTTTTTCTTTGCTTAGGGAGTATTTTTTTATCCCTGAAAAATTTAATTTTATAAGAATACAGGGTTT
AGATATTTTAAAGGATTGTCAAGGCTCAAATTTGAGTATTCAATTTAAGTTCAATAAAATTTTTCCAAAG
AATTGCATCGTCAGAGCAGATTTATTTTCTTTAAGCATTACGCCTATTGTGAATATTTTTCCCAAAAATG
CAGAATCAATTATTAATGACCATACCAAAGATGGATATAGGATTTTTGTAGATAGGGTGCATTTAGATTC
TTATGAAATTATAAAGATTAATCAAGTCAAAGCTCACAATAGTGATAGTGGAAGAAGGATTCTTAAAAAT
TATAAGAGTTTTGAACGTTTTGAGTTTTTAAAAGACAATCAAAATGAATTTTATAGTATAAATGTTAAAA
AAAATTCTAAAGGTGAAACATACAAAGAAATTTCTTTTTTTTCAGGGCATTCTTACAATGAGATAATTAC
CATTGATGCTTTGTGTTGTAATAAGAATTTACCCTCTAAGCTTAAGATAGGCGATATAAGACATATTAAT
TTTGAGGATATATCCACTAAAAATATTAAAATCCCAAGTATGATGAGAGAATATAGCGTTGATGGGCATT
TACTTTGGAAGCTTGTATCTATACTCTCTTTTAATTATCAAAGTATTCTTAATACAACTTCATTTTTTGG
AGTATTAGAAAGTTATAGTTTTGTCAATGACAAGGAGAATGAAGAAACTTATAAGCGTTTAAAAAATTCT
ATTGCATATATAGAATCTAAATCGACTTACCTCGTTGATGAATACATTACAAAAAAGGGAACACTCTGTA
TAATGGGCATTAAGGATTCTAATTTTTATTCTTTGGGAGAAGTTTATAAATTAGGGCTTATAATATCTAA
ATTTTTTGCTTCTTTTGTAAGCATTAATTCTTTTTGCGAATTAAAGATAAAATGCTTGGATAGCAAAGAG
ATTTTGTATTATCCAGCTACTCGCGGCAAAAAAGTTTCTTTATGA