SecReT6
Protein ID: 471316102
SecReT6 ID737
T6SS typei1
Gene symbol-
Locus tagHCBAA847_1596
StrainHelicobacter cinaedi ATCC BAA-847
Repliconchromosome [GenBank: NC_020555] [Browse all T6SS(s) in this replicon]
Location [Strand]1534454..1534846 [-]
Producthypothetical protein
NoteTssE
UniProt IDI7GZC9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.00E-09, Aligned region: 24..107
Protein Sequence: 130 a.a.     [Download]
>gi|471316102|ref|YP_007601457.1| conserved hypothetical protein [Helicobacter cinaedi ATCC BAA-847]
MSLLGKIIHQLDDQCQNIPFYQNEFEDIKTNIQALLNTKLDDCIIANDLGLSNVVEFNLNASDLCFKMAK
EIHFLISKYERRIRILSIRYDNSLTPWQISFFLQCNFFQDHFKEFSLEIIFKNDRYCEVF
 
Nucleotide Sequence: 393 bp     [Download]
>gi|471314537|ref|NC_020555.1|:c1534846-1534454 Helicobacter cinaedi ATCC BAA-847 DNA, complete genome
ATGTCATTGCTTGGCAAGATCATTCATCAGTTAGACGATCAGTGTCAAAATATTCCTTTTTATCAAAACG
AATTTGAGGATATTAAGACCAACATTCAAGCTTTACTTAATACCAAGTTAGATGATTGTATTATAGCTAA
TGATTTGGGTTTGTCAAATGTTGTAGAATTTAATTTAAACGCAAGTGATTTATGCTTCAAAATGGCTAAA
GAGATTCATTTCCTTATAAGCAAATATGAGCGGAGAATTAGAATCTTATCTATTCGTTATGACAATTCTT
TGACGCCTTGGCAAATTTCATTCTTTTTGCAATGCAATTTTTTTCAAGACCATTTTAAAGAATTTAGTTT
AGAAATTATTTTTAAAAATGATAGATATTGTGAGGTCTTTTAG