SecReT6
Protein ID: 471316103
SecReT6 ID737
T6SS typei1
Gene symbolevpB
Locus tagHCBAA847_1597
StrainHelicobacter cinaedi ATCC BAA-847
Repliconchromosome [GenBank: NC_020555] [Browse all T6SS(s) in this replicon]
Location [Strand]1534849..1536303 [-]
ProductVC_A0108 family type VI secretion protein
NoteTssC
UniProt IDI7HDK1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 4.90E-179, Aligned region: 57..482
Protein Sequence: 484 a.a.     [Download]
>gi|471316103|ref|YP_007601458.1| VC_A0108 family type VI secretion protein [Helicobacter cinaedi ATCC BAA-847]
MSSDKVVDTPIIESIMEKSKYLKNDESYSIAKRGVAEFISAIVENDDVEDKINKFALDEMIAHIDDLVSK
QMDEILHNEDFQKLESVWRGLYFLVERTDFNENIKINLFDVTKEEALEDFENNPDITQSVIYKNIYSSEY
GQFGGEPVGAIIGDYQLSTNSPDMTFLNKMASIAAMSHSPFLTSCAPSFFGLENYSELANIQDLGGLLQG
PQYTRWRTFRENEDSKYVGLMVTRFLTRSPYSPEENPIKTFNYKENVHNSHNHLLWGNSAYAFATRLTES
FAKYRWCGSIIGPKSGGSVKDLPTYLYESFGTMQSKIPTEVLITDRREYELAEAGFIALTLRRDSNNAAF
FSANSALKPKVFPNTPEGKEAETNYRLGTQLPYIFLISRLAHYLKVLQREEIGSWKERTDIENGLNEWVR
QYISDQENPPAEVRSRRPFRGVQIKVDNVAGEPGWYKIGLSVRPHFKYMGGNFELSLVGKLDKE
 
Nucleotide Sequence: 1455 bp     [Download]
>gi|471314537|ref|NC_020555.1|:c1536303-1534849 Helicobacter cinaedi ATCC BAA-847 DNA, complete genome
ATGTCAAGCGATAAAGTGGTTGATACACCTATTATTGAAAGCATTATGGAAAAAAGTAAGTATTTAAAAA
ATGATGAAAGTTATAGTATAGCTAAAAGAGGTGTTGCCGAATTTATCTCTGCTATTGTTGAGAATGATGA
TGTAGAAGATAAAATTAATAAATTTGCTTTAGATGAGATGATAGCACATATTGATGATTTAGTATCTAAG
CAAATGGACGAGATTCTACACAATGAGGATTTCCAAAAACTAGAGTCTGTATGGAGAGGCTTATATTTCT
TAGTAGAAAGAACAGATTTTAATGAAAATATTAAAATCAACCTTTTTGATGTAACCAAAGAAGAAGCTTT
AGAAGATTTTGAGAACAATCCTGATATTACCCAAAGTGTCATTTATAAAAATATTTATTCTTCAGAATAT
GGACAATTTGGTGGAGAGCCTGTTGGTGCTATCATAGGCGATTATCAGCTTAGCACCAATAGTCCAGATA
TGACTTTTTTAAATAAAATGGCAAGTATTGCTGCAATGAGCCATTCGCCATTTTTAACCTCTTGTGCTCC
TAGTTTTTTTGGGTTAGAGAATTATTCAGAGTTAGCAAATATTCAAGATTTAGGAGGTTTGCTTCAAGGT
CCTCAATACACTAGATGGAGAACCTTTAGAGAAAATGAAGATTCAAAATATGTGGGGCTTATGGTAACAA
GATTTTTAACACGCTCTCCTTATAGTCCAGAAGAAAATCCTATCAAAACTTTTAATTATAAAGAAAATGT
TCATAATTCACATAATCATTTATTATGGGGCAATTCAGCTTATGCCTTTGCTACAAGATTAACTGAAAGT
TTTGCAAAATATAGATGGTGTGGAAGTATTATAGGTCCAAAAAGTGGAGGGAGCGTGAAAGATTTACCTA
CTTATCTTTACGAGAGTTTTGGCACTATGCAATCCAAGATTCCAACCGAAGTGCTTATTACAGATAGAAG
AGAATATGAGCTTGCTGAAGCAGGGTTTATTGCTTTGACTTTAAGAAGAGATAGTAATAATGCAGCTTTT
TTCTCTGCAAATTCAGCTTTAAAACCTAAAGTATTTCCAAATACACCTGAGGGAAAGGAAGCAGAAACGA
ATTATCGATTGGGAACACAGCTTCCTTATATATTCCTTATATCAAGATTAGCACATTATCTTAAGGTTTT
ACAAAGAGAAGAAATAGGTAGTTGGAAAGAAAGAACTGATATTGAAAACGGACTCAACGAATGGGTAAGA
CAATATATTTCAGACCAAGAAAATCCTCCTGCTGAAGTCCGAAGTAGGAGACCATTTAGAGGAGTTCAGA
TCAAAGTGGATAATGTGGCTGGAGAGCCGGGATGGTATAAGATAGGGCTTAGTGTTCGCCCTCATTTTAA
ATATATGGGCGGAAATTTCGAACTTTCATTAGTGGGCAAACTTGATAAAGAGTGA